Probable acyltransferase yihG (yihG) Recombinant Protein | yihG recombinant protein

Recombinant Escherichia coli Probable acyltransferase yihG (yihG)

Gene Names

yihG; ECK3854; JW3834

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Probable acyltransferase yihG (yihG); Recombinant Escherichia coli Probable acyltransferase yihG (yihG); Recombinant Probable acyltransferase yihG (yihG); Probable acyltransferase yihG EC= 2.3.-.-; yihG recombinant protein

Ordering

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

1-310

Sequence

MANLLNKFIMTRILAAITLLLSIVLTILVTIFCSVPIIIAGIVKLLLPVPVIWRKVSRFCDFMMYCWCEGLAVLLHLNPHLQWEVHGLEGLSKKNWYLLICNHRSWADIVVLCVLFRKHIPMNKYFLKQQLAWVPFLGLACWSLDMPFMKRYSRAYLLRHPERRGKDVETTRRSCEKFRLHPTTIVNFVEGSRFTQEKHQQTHSTFQNLLPPKAAGIAMALNVLGKQFDKLLNVTLCYPDNNRQPFFDMLSGKLTRIVVHVDLQPIADELHGDYINDKSFKRHFQQWLNSLWQEKDRLLTSLMSSQRQNK

Sequence Length

310

Species

Escherichia coli (strain K12)

Preparation and Storage

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #

16131703

NCBI GeneID

948350

NCBI Accession #

NP_418299.1

NCBI GenBank Nucleotide #

NC_000913.2

UniProt Accession #

P32129; Q2M8G0

Molecular Weight

36,289 Da

NCBI Official Full Name

inner membrane protein, Predicted acyltransferas

NCBI Official Symbol

yihG

NCBI Official Synonym Symbols

ECK3854; JW3834

NCBI Protein Information

inner membrane protein, Predicted acyltransferas

UniProt Protein Name

Probable acyltransferase YihG

Protein Family

Probable acyltransferase

UniProt Gene Name

yihG

UniProt Entry Name

YIHG_ECOLI

NCBI Description

YihG was originally characterized as poly(A) polymerase II, but this claim has been contradicted. [More information is available at EcoGene: EG11833]. YihG was thought to function as a second poly(A) polymerase , but further work showed that this protein does not have poly(A) polymerase activity . [More information is available at EcoCyc: EG11833].

Uniprot Description

Subcellular location: Cell inner membrane; Multi-pass membrane protein.

Induction: In stationary phase. Ref.4

Domain: The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate

By similarity.

Sequence similarities: Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.

Caution: Was originally (Ref.4) thought to be a poly(A) polymerase II.

Similar Products

Product Notes

The yihG yihg (Catalog #AAA1003370) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-310. The amino acid sequence is listed below: MANLLNKFIM TRILAAITLL LSIVLTILVT IFCSVPIIIA GIVKLLLPVP VIWRKVSRFC DFMMYCWCEG LAVLLHLNPH LQWEVHGLEG LSKKNWYLLI CNHRSWADIV VLCVLFRKHI PMNKYFLKQQ LAWVPFLGLA CWSLDMPFMK RYSRAYLLRH PERRGKDVET TRRSCEKFRL HPTTIVNFVE GSRFTQEKHQ QTHSTFQNLL PPKAAGIAMA LNVLGKQFDK LLNVTLCYPD NNRQPFFDML SGKLTRIVVH VDLQPIADEL HGDYINDKSF KRHFQQWLNS LWQEKDRLLT SLMSSQRQNK. It is sometimes possible for the material contained within the vial of "Probable acyltransferase yihG (yihG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...