SDS-PAGE
Uncharacterized protein YihF Recombinant Protein | yihF recombinant protein
Recombinant Escherichia coli (strain K12) Uncharacterized protein YihF
Gene Names
yihF; ECK3853; JW5574
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized protein YihF; Recombinant Escherichia coli (strain K12) Uncharacterized protein YihF; Escherichia coli (strain K12); yihF recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-476aa; Full Length
Sequence
GTQIQPGVEKFIKDFNDAKKKGEHAYDMTLSYQNFDKGFFNSRFQMQMTFDNGAPDLNIKPGQKVVFDVDVEHGPLPITMLMHGNVIPALAAAKVNLVNNELTQPLFIAAKNKSPVEATLRFAFGGSFSTTLDVAPAEYGKFSFGEGQFTFNGDGSSLSNLDIEGKVEDIVLQLSPMNKVTAKSFTIDSLARLEEKKFPVGESESKFNQINIINHGEDVAQIDAFVAKTRLDRVKDKDYINVNLTYELDKLTKGNQQLGSGEWSLIAESIDPSAVRQFIIQYNIAMQKQLAAHPELANDEVALQEVNAALFKEYLPLLQKSEPTIKQPVRWKNALGELNANLDISIADPAKSSSSTNKDIKSLNFDVKLPLNVVTETAKQLNLSEGMDAEKAQKQADKQISGMMTLGQMFQLITIDNNTASLQLRYTPGKVVFNGQEMSEEEFMSRAGRFVH
Sequence Length
476
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
References
"The Escherichia coli dsbA gene is partly transcribed from the promoter of a weakly expressed upstream gene."
Belin P., Boquet P.L.
Microbiology 140:3337-3348(1994)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
66.1 kDa
NCBI Official Full Name
DUF945 family protein
NCBI Official Symbol
yihF
NCBI Official Synonym Symbols
ECK3853; JW5574
NCBI Protein Information
DUF945 family protein
UniProt Protein Name
Uncharacterized protein YihF
UniProt Gene Name
yihF
UniProt Entry Name
YIHF_ECOLI
Uniprot Description
Enzyme and pathway databasesBioCyc Collection of Pathway/Genome Databases<br/><a href='/database/5'>More..</a>BioCyciEcoCyc:EG11832-MONOMER. ECOL316407:JW5574-MONOMER.
Similar Products
Product Notes
The yihF yihf (Catalog #AAA1207082) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-476aa; Full Length. The amino acid sequence is listed below: GTQIQPGVEK FIKDFNDAKK KGEHAYDMTL SYQNFDKGFF NSRFQMQMTF DNGAPDLNIK PGQKVVFDVD VEHGPLPITM LMHGNVIPAL AAAKVNLVNN ELTQPLFIAA KNKSPVEATL RFAFGGSFST TLDVAPAEYG KFSFGEGQFT FNGDGSSLSN LDIEGKVEDI VLQLSPMNKV TAKSFTIDSL ARLEEKKFPV GESESKFNQI NIINHGEDVA QIDAFVAKTR LDRVKDKDYI NVNLTYELDK LTKGNQQLGS GEWSLIAESI DPSAVRQFII QYNIAMQKQL AAHPELANDE VALQEVNAAL FKEYLPLLQK SEPTIKQPVR WKNALGELNA NLDISIADPA KSSSSTNKDI KSLNFDVKLP LNVVTETAKQ LNLSEGMDAE KAQKQADKQI SGMMTLGQMF QLITIDNNTA SLQLRYTPGK VVFNGQEMSE EEFMSRAGRF VH. It is sometimes possible for the material contained within the vial of "Uncharacterized protein YihF, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
