Probable xyloglucan endotransglucosylase/hydrolase protein 27 (XTH27) Recombinant Protein | XTH27 recombinant protein

Recombinant Arabidopsis thaliana Probable xyloglucan endotransglucosylase/hydrolase protein 27 (XTH27)

Gene Names

EXGT-A3; ATXTH27; endoxyloglucan transferase A3; T23K3.4; T23K3_4; XTH27; XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Probable xyloglucan endotransglucosylase/hydrolase protein 27 (XTH27); Recombinant Arabidopsis thaliana Probable xyloglucan endotransglucosylase/hydrolase protein 27 (XTH27); XTH27 recombinant protein

Ordering
Cat. Num. AAA1312996 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

21-333, Full length protein

Sequence

FALQNLPITSFEESYTQLFGDKNLFVHQDGKSVRLTLDERTGSGFVSNDYYLHGFFSASIKLPSDYTAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIREKEWRVQTNIYGNGSTHSGREERYNLWFDPTEDFHQYSILWSDSHIIFFVDNVPIREVKRTAEMGGHFPSKPMSLYTTIWDGSKWATNGGKYGVNYKYAPYIARFSDLVLHGCPVDPIEQFPRCDEGAAEDMRAAQEITPSQRSKMDVFRRRLMTYSYCYDRARYNVALSECVVNPAEAQRLRVYDPVRFGGIPRRHRNGKHRSKRSRVDGTESI

Sequence Length

313

Species

Arabidopsis thaliana (Mouse-ear cress)

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #

15226364

NCBI GeneID

814716

NCBI Accession #

NP_178294.1

NCBI GenBank Nucleotide #

NM_126246.4

UniProt Accession #

Q8LDS2; O04906; Q9SEB1; B9DI46

Molecular Weight

38,415 Da

NCBI Official Full Name

endoxyloglucan transferase A3

NCBI Official Symbol

EXGT-A3

NCBI Official Synonym Symbols

ATXTH27; endoxyloglucan transferase A3; T23K3.4; T23K3_4; XTH27; XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27

NCBI Protein Information

endoxyloglucan transferase A3

UniProt Protein Name

Probable xyloglucan endotransglucosylase/hydrolase protein 27

Protein Family

Probable xyloglucan endotransglucosylase/hydrolase protein

UniProt Gene Name

XTH27

UniProt Synonym Gene Names

EXGT-A3; At-XTH27; XTH-27

NCBI Description

EXGT-A3 has homology to xyloglucan endotransglucosylases/hydrolases (XTHs). Mutants in this gene show a lesion mimic phenotype associated with leaf maturation and a reduction in the number of tertiary veins. Individual tracheary elements in the mutants are shorter, but phloem transport activity is not severely affected. EXGT-A3 plays a role in xyloglucan degradation in the differentiating tracheary elements of rosette leaves.

Uniprot Description

Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (). Required for cell wall modification during the development of tracheary elements.

Research Articles on XTH27

1. XTH27 plays a role in the generation of tracheary elements in the rosette leaves of Arabidopsis. [AtXTH27]

Similar Products

Product Notes

The XTH27 xth27 (Catalog #AAA1312996) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-333, Full length protein. The amino acid sequence is listed below: FALQNLPITS FEESYTQLFG DKNLFVHQDG KSVRLTLDER TGSGFVSNDY YLHGFFSASI KLPSDYTAGV VVAFYMSNGD MYEKNHDEID FEFLGNIREK EWRVQTNIYG NGSTHSGREE RYNLWFDPTE DFHQYSILWS DSHIIFFVDN VPIREVKRTA EMGGHFPSKP MSLYTTIWDG SKWATNGGKY GVNYKYAPYI ARFSDLVLHG CPVDPIEQFP RCDEGAAEDM RAAQEITPSQ RSKMDVFRRR LMTYSYCYDR ARYNVALSEC VVNPAEAQRL RVYDPVRFGG IPRRHRNGKH RSKRSRVDGT ESI. It is sometimes possible for the material contained within the vial of "Probable xyloglucan endotransglucosylase/hydrolase protein 27 (XTH27), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...