Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DNA repair protein XRCC4 (Xrcc4) Recombinant Protein | Xrcc4 recombinant protein

Recombinant Mouse DNA repair protein XRCC4 (Xrcc4)

Gene Names
Xrcc4; AW413319; AW545101; 2310057B22Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA repair protein XRCC4 (Xrcc4); Recombinant Mouse DNA repair protein XRCC4 (Xrcc4); Xrcc4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-326, full length protein
Sequence
MERKVSRIYLASEPNVPYFLQVSWERAIGSGFVITLTDGHSAWTATVSELEISQEADDMAMEKGKYIDELRKALVPGSGAAGTYKFLFSKESQHFSLEKELKDVSFRLGSFNLDKVSNSAEVIRELICYCLDTITEKQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALEADLYQRFILVLNEKKTKIRSLHKLLNEVQQLEESTKPERENPCSDKTPEEHGLYDGSTDEESGAPVQAAETLHKDDSIFSSPDVTDIAPSRKRRHRMQKNLGTEPKMAPQELPLQEKERLASSLPQTLKEESTSAENMSLETLRNSSPEDLFD
Sequence Length
326
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Xrcc4 recombinant protein
This protein functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. The non-homologous end-joining pathway is required both for normal development and for suppression of tumors. This gene functionally complements XR-1 Chinese hamster ovary cell mutant, which is impaired in DNA double-strand breaks produced by ionizing radiation and restriction enzymes. Alternative transcription initiation and alternative splicing generates several transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,708 Da
NCBI Official Full Name
DNA repair protein XRCC4
NCBI Official Synonym Full Names
X-ray repair complementing defective repair in Chinese hamster cells 4
NCBI Official Symbol
Xrcc4
NCBI Official Synonym Symbols
AW413319; AW545101; 2310057B22Rik
NCBI Protein Information
DNA repair protein XRCC4
UniProt Protein Name
DNA repair protein XRCC4
Protein Family
UniProt Gene Name
Xrcc4

Uniprot Description

Involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. Binds to DNA and to DNA ligase IV (LIG4). The LIG4-XRCC4 complex is responsible for the NHEJ ligation step, and XRCC4 enhances the joining activity of LIG4. Binding of the LIG4-XRCC4 complex to DNA ends is dependent on the assembly of the DNA-dependent protein kinase complex DNA-PK to these DNA ends ().

Research Articles on Xrcc4

Similar Products

Product Notes

The Xrcc4 xrcc4 (Catalog #AAA1460990) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-326, full length protein. The amino acid sequence is listed below: MERKVSRIYL ASEPNVPYFL QVSWERAIGS GFVITLTDGH SAWTATVSEL EISQEADDMA MEKGKYIDEL RKALVPGSGA AGTYKFLFSK ESQHFSLEKE LKDVSFRLGS FNLDKVSNSA EVIRELICYC LDTITEKQAK NEHLQKENER LLRDWNDVQG RFEKCVSAKE ALEADLYQRF ILVLNEKKTK IRSLHKLLNE VQQLEESTKP ERENPCSDKT PEEHGLYDGS TDEESGAPVQ AAETLHKDDS IFSSPDVTDI APSRKRRHRM QKNLGTEPKM APQELPLQEK ERLASSLPQT LKEESTSAEN MSLETLRNSS PEDLFD. It is sometimes possible for the material contained within the vial of "DNA repair protein XRCC4 (Xrcc4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.