Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Xaa-Pro aminopeptidase 2 (XPNPEP2) Recombinant Protein | XPNPEP2 recombinant protein

Recombinant Human Xaa-Pro aminopeptidase 2 (XPNPEP2)

Gene Names
XPNPEP2; APP2; AEACEI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Xaa-Pro aminopeptidase 2 (XPNPEP2); Recombinant Human Xaa-Pro aminopeptidase 2 (XPNPEP2); XPNPEP2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-649, Full length protein
Sequence
HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLA
Sequence Length
628
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for XPNPEP2 recombinant protein
Aminopeptidase P is a hydrolase specific for N-terminal imido bonds, which are common to several collagen degradation products, neuropeptides, vasoactive peptides, and cytokines. Structurally, the enzyme is a member of the pita bread fold family and occurs in mammalian tissues in both soluble and GPI-anchored membrane-bound forms. A membrane-bound and soluble form of this enzyme have been identified as products of two separate genes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,625 Da
NCBI Official Full Name
xaa-Pro aminopeptidase 2
NCBI Official Synonym Full Names
X-prolyl aminopeptidase 2
NCBI Official Symbol
XPNPEP2
NCBI Official Synonym Symbols
APP2; AEACEI
NCBI Protein Information
xaa-Pro aminopeptidase 2
UniProt Protein Name
Xaa-Pro aminopeptidase 2
UniProt Gene Name
XPNPEP2
UniProt Synonym Gene Names
Membrane-bound APP; Membrane-bound AmP; mAmP

NCBI Description

Aminopeptidase P is a hydrolase specific for N-terminal imido bonds, which are common to several collagen degradation products, neuropeptides, vasoactive peptides, and cytokines. Structurally, the enzyme is a member of the 'pita bread fold' family and occurs in mammalian tissues in both soluble and GPI-anchored membrane-bound forms. A membrane-bound and soluble form of this enzyme have been identified as products of two separate genes. [provided by RefSeq, Jul 2008]

Uniprot Description

Membrane-bound metalloprotease which catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro. May play a role in the metabolism of the vasodilator bradykinin.

Research Articles on XPNPEP2

Similar Products

Product Notes

The XPNPEP2 xpnpep2 (Catalog #AAA1049043) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-649, Full length protein. The amino acid sequence is listed below: HTKPVDLGGQ DVRNCSTNPP YLPVTVVNTT MSLTALRQQM QTQNLSAYII PGTDAHMNEY IGQHDERRAW ITGFTGSAGT AVVTMKKAAV WTDSRYWTQA ERQMDCNWEL HKEVGTTPIV TWLLTEIPAG GRVGFDPFLL SIDTWESYDL ALQGSNRQLV SITTNLVDLV WGSERPPVPN QPIYALQEAF TGSTWQEKVS GVRSQMQKHQ KVPTAVLLSA LEETAWLFNL RASDIPYNPF FYSYTLLTDS SIRLFANKSR FSSETLSYLN SSCTGPMCVQ IEDYSQVRDS IQAYSLGDVR IWIGTSYTMY GIYEMIPKEK LVTDTYSPVM MTKAVKNSKE QALLKASHVR DAVAVIRYLV WLEKNVPKGT VDEFSGAEIV DKFRGEEQFS SGPSFETISA SGLNAALAHY SPTKELNRKL SSDEMYLLDS GGQYWDGTTD ITRTVHWGTP SAFQKEAYTR VLIGNIDLSR LIFPAATSGR MVEAFARRAL WDAGLNYGHG TGHGIGNFLC VHEWPVGFQS NNIAMAKGMF TSIEPGYYKD GEFGIRLEDV ALVVEAKTKY PGSYLTFEVV SFVPYDRNLI DVSLLSPEHL QYLNRYYQTI REKVGPELQR RQLLEEFEWL QQHTEPLA. It is sometimes possible for the material contained within the vial of "Xaa-Pro aminopeptidase 2 (XPNPEP2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.