Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PTPN18 expression in transfected 293T cell line by PTPN18 polyclonal antibody. Lane 1: PTPN18 transfected lysate (38.61kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human PTPN18 Polyclonal Antibody | anti-PTPN18 antibody

PTPN18 (Tyrosine-protein Phosphatase Non-receptor Type 18, Brain-derived Phosphatase, BDP1, PTP-HSCF)

Gene Names
PTPN18; BDP1; PTP-HSCF
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PTPN18; Polyclonal Antibody; PTPN18 (Tyrosine-protein Phosphatase Non-receptor Type 18; Brain-derived Phosphatase; BDP1; PTP-HSCF); Anti -PTPN18 (Tyrosine-protein Phosphatase Non-receptor Type 18; anti-PTPN18 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PTPN18.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSRSLDSARSFLERLEARGGREGAVLAGEFSKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTFQKESRSVYQLQYMSWPDRGVPSSPDHMLAMVEEARRLQGSGPEPLCVHCSAGCGRTGVLCTVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCSTLQNASPHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAMADTYAVVQKRGAPAGAGSGTQTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV
Applicable Applications for anti-PTPN18 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Western Blot and Immunofluorescence.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human PTPN18, aa1-351 (AAH52800.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PTPN18 expression in transfected 293T cell line by PTPN18 polyclonal antibody. Lane 1: PTPN18 transfected lysate (38.61kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PTPN18 expression in transfected 293T cell line by PTPN18 polyclonal antibody. Lane 1: PTPN18 transfected lysate (38.61kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to PTPN18 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified antibody to PTPN18 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-PTPN18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
50,482 Da
NCBI Official Full Name
PTPN18 protein
NCBI Official Synonym Full Names
protein tyrosine phosphatase, non-receptor type 18 (brain-derived)
NCBI Official Symbol
PTPN18
NCBI Official Synonym Symbols
BDP1; PTP-HSCF
NCBI Protein Information
tyrosine-protein phosphatase non-receptor type 18; brain-derived phosphatase
UniProt Protein Name
Tyrosine-protein phosphatase non-receptor type 18
UniProt Gene Name
PTPN18
UniProt Synonym Gene Names
BDP1
UniProt Entry Name
PTN18_HUMAN

NCBI Description

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, the mitotic cycle, and oncogenic transformation. This PTP contains a PEST motif, which often serves as a protein-protein interaction domain, and may be related to protein intracellular half-live. This protein can differentially dephosphorylate autophosphorylated tyrosine kinases that are overexpressed in tumor tissues, and it appears to regulate HER2, a member of the epidermal growth factor receptor family of receptor tyrosine kinases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008]

Uniprot Description

BDP1: a member of the non-receptor protein tyrosine phosphatase (PTP) family. Contains a PEST motif, which often serves as a protein-protein interaction domain, and may be related to protein intracellular half-live. This gene was found to be expressed in brain, colon tissues, and several different tumor-derived cell lines.

Protein type: Motility/polarity/chemotaxis; Protein phosphatase, tyrosine (non-receptor); EC 3.1.3.48

Chromosomal Location of Human Ortholog: 2q21.1

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; non-membrane spanning protein tyrosine phosphatase activity

Biological Process: protein amino acid dephosphorylation

Research Articles on PTPN18

Similar Products

Product Notes

The PTPN18 ptpn18 (Catalog #AAA6010256) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PTPN18 (Tyrosine-protein Phosphatase Non-receptor Type 18, Brain-derived Phosphatase, BDP1, PTP-HSCF) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTPN18 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Western Blot and Immunofluorescence. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the PTPN18 ptpn18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSRSLDSARS FLERLEARGG REGAVLAGEF SKRCERYWAQ EQEPLQTGLF CITLIKEKWL NEDIMLRTLK VTFQKESRSV YQLQYMSWPD RGVPSSPDHM LAMVEEARRL QGSGPEPLCV HCSAGCGRTG VLCTVDYVRQ LLLTQMIPPD FSLFDVVLKM RKQRPAAVQT EEQYRFLYHT VAQMFCSTLQ NASPHYQNIK ENCAPLYDDA LFLRTPQALL AIPRPPGGVL RSISVPGSPG HAMADTYAVV QKRGAPAGAG SGTQTGTGTG ARSAEEAPLY SKVTPRAQRP GAHAEDARGT LPGRVPADQS PAGSGAYEDV AGGAQTGGLG FNLRIGRPKG PRDPPAEWTR V. It is sometimes possible for the material contained within the vial of "PTPN18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.