Protein Wnt-7b (Wnt7b) Recombinant Protein | Wnt7b recombinant protein

Recombinant Mouse Protein Wnt-7b (Wnt7b)

Cat. Num. AAA959001

• Gene Names: Wnt7b; Wnt-7b
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein Wnt-7b (Wnt7b); Recombinant Mouse Protein Wnt-7b (Wnt7b); Protein Wnt-7b; Wnt7b recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 25-349aa; Full Length of Mature Protein
• Sequence: ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK

• Species: Mus musculus (Mouse)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for Wnt7b recombinant protein

Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters.

Product Categories/Family for Wnt7b recombinant protein

Stem Cells

NCBI and Uniprot Product Information

• NCBI GI #: 254692924
• NCBI GeneID: 22422
• NCBI Accession #: NP_001157105.1
• NCBI GenBank Nucleotide #: NM_001163633.1
• UniProt Accession #: P28047; Q80US5
• Molecular Weight: 56.3 kDa
• NCBI Official Full Name: protein Wnt-7b isoform 3
• NCBI Official Synonym Full Names: wingless-type MMTV integration site family, member 7B
• NCBI Official Symbol: Wnt7b
• NCBI Official Synonym Symbols: Wnt-7b
• NCBI Protein Information: protein Wnt-7b; wingless-related MMTV integration site 7B
• UniProt Protein Name: Protein Wnt-7b
• Protein Family: Protein
• UniProt Gene Name: Wnt7b
• UniProt Synonym Gene Names: Wnt-7b
• UniProt Entry Name: WNT7B_MOUSE

Uniprot Description

WNT7B: Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. Belongs to the Wnt family.

Protein type: Secreted; Secreted, signal peptide

Cellular Component: proteinaceous extracellular matrix; extracellular space; cell surface; cytoplasm; plasma membrane; extracellular region

Molecular Function: protein binding; frizzled binding; receptor agonist activity; receptor binding

Biological Process: oxygen homeostasis; multicellular organismal development; cell proliferation in forebrain; positive regulation of JNK cascade; Wnt receptor signaling pathway through beta-catenin; signal transduction; anatomical structure regression; activation of JNK activity; negative regulation of neurogenesis; neuron differentiation; cellular metabolic process; central nervous system vasculogenesis; homeostatic process; vasculature development; positive regulation of cell proliferation; regulation of cell projection size; synapse organization and biogenesis; establishment and/or maintenance of polarity of embryonic epithelium; angiogenesis; neurite development; Wnt receptor signaling pathway; cell fate commitment; in utero embryonic development; odontogenesis of dentine-containing teeth; positive regulation of osteoblast differentiation; stem cell development; negative regulation of smoothened signaling pathway; embryonic organ development; smooth muscle cell differentiation; neurite morphogenesis; lung development