Protein Wnt-7b (WNT7B) Recombinant Protein | WNT7B recombinant protein

Recombinant Human Protein Wnt-7b (WNT7B)

Cat. Num. AAA963405

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein Wnt-7b (WNT7B); Recombinant Human Protein Wnt-7b (WNT7B); Recombinant Protein Wnt-7b (WNT7B); Protein Wnt-7b; WNT7B recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 25-349aa; Full Length of Mature Protein
• Sequence: ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

SDS-PAGE

Related Product Information for WNT7B recombinant protein

Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters

Product Categories/Family for WNT7B recombinant protein

Stem Cells

NCBI and Uniprot Product Information

• NCBI GI #: 17505193
• NCBI GeneID: 7477
• NCBI Accession #: NP_478679.1
• NCBI GenBank Nucleotide #: NM_058238.2
• UniProt Accession #: P56706; Q96Q12; B8A596
• Molecular Weight: 40.2 kDa
• NCBI Official Full Name: protein Wnt-7b
• NCBI Official Synonym Full Names: wingless-type MMTV integration site family, member 7B
• NCBI Official Symbol: WNT7B
• NCBI Protein Information: protein Wnt-7b
• UniProt Protein Name: Protein Wnt-7b
• Protein Family: Protein
• UniProt Gene Name: WNT7B
• UniProt Entry Name: WNT7B_HUMAN

NCBI Description

This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Among members of the human WNT family, this gene product is most similar to WNT7A protein. [provided by RefSeq, Oct 2008]

Uniprot Description

WNT7B: Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. Belongs to the Wnt family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 22q13

Cellular Component: proteinaceous extracellular matrix; extracellular space; Golgi lumen; endoplasmic reticulum lumen; extracellular region; plasma membrane

Molecular Function: frizzled binding

Biological Process: oxygen homeostasis; response to glucocorticoid stimulus; positive regulation of JNK cascade; Wnt receptor signaling pathway through beta-catenin; forebrain regionalization; anatomical structure regression; activation of JNK activity; neuron differentiation; cellular metabolic process; central nervous system vasculogenesis; homeostatic process; fibroblast proliferation; positive regulation of cell proliferation; regulation of cell projection size; synapse organization and biogenesis; establishment and/or maintenance of polarity of embryonic epithelium; Wnt receptor signaling pathway; cell fate commitment; in utero embryonic development; odontogenesis of dentine-containing teeth; positive regulation of osteoblast differentiation; negative regulation of smoothened signaling pathway; embryonic organ development; smooth muscle cell differentiation; neurite morphogenesis; lung development