Wnt-5a recombinant protein

Human Wnt-5a

Cat. Num. AAA692220

• Gene Names: WNT5A; hWNT5A
• Reactivity: Human
• Purity: > 90% by SDS-PAGE & Coomassie stain
• Synonyms: Wnt-5a; Human Wnt-5a; Wnt-5a recombinant protein

• Host: E Coli
• Reactivity: Human
• Purity/Purification: > 90% by SDS-PAGE & Coomassie stain
• Form/Format: Lyophilized; 50mM acetic acid
• Sequence: Protein Sequence: MIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRH RRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELS TCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGS YESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFR KVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCV RNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH WCCYVKCKKCTEIVDQFVCKLEHHHHHH
• Sequence Length: 328

• Application Notes: No direct biological data available at the moment but human Wnt5a binds to immobilized human sROR2 in a functional ELISA.
• Species: Human
• Length (aa): 328
• Stabilizer: None
• Result by N-terminal sequencing: MIIGA
• Reconstitution: Human Wnt5a should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20 degree C.
• Preparation and Storage: The lyophilized human Wnt5a, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human Wnt5a should be stored in working aliquots at -20°C.

SDS-PAGE

(SDS-PAGE analysis of recombinant human Wnt5a. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.)

Testing Data

(Binding of recombinant human Wnt5a [Cat# MBS692220] to recombinant human sROR2 in a functional ELISA. sROR2 was coated with 2ug/ml (100ug/well) and increasing amounts of Wnt5a was added. Detection was performed using a polyclonal rabbit anti-human Wnt5a and a goat anti-rabbit Biotin conjugated secondary antibody.)

Related Product Information for Wnt-5a recombinant protein

Wnt-5a is one of the most highly investigated non-canonical Wnts and has been implicated in almost all aspects of non-canonical Wnt signalling. In terms of cancer development, Wnt-5a has, until recently, lived in the shadow of its better-characterised relatives. This was largely because of its apparent inability to transform cells or signal through the canonical beta-catenin pathway that is so important in cancer, particularly colorectal cancer. Recent work in a wide range of human tumours has pointed to a critical role for Wnt-5a in malignant progression, but there is conflicting evidence whether Wnt-5a has a tumour-promoting or -suppressing role. Emerging evidence suggests that the functions of Wnt-5a can be drastically altered depending on the availability of key receptors. Hence, the presence or absence of these receptors may go some way to explain the conflicting role of Wnt-5a in different cancers.

Product Categories/Family for Wnt-5a recombinant protein

Recombinant protein; Cytokines & Growth Factors; Wnt-5a

NCBI and Uniprot Product Information

• NCBI GI #: 371502087
• NCBI GeneID: 7474
• NCBI Accession #: NP_003383.2
• NCBI GenBank Nucleotide #: NM_001256105.1
• UniProt Accession #: P41221; Q6P278; A8K4A4
• Molecular Weight: 36.9kDa
• NCBI Official Full Name: protein Wnt-5a isoform 2
• NCBI Official Synonym Full Names: wingless-type MMTV integration site family, member 5A
• NCBI Official Symbol: WNT5A
• NCBI Official Synonym Symbols: hWNT5A
• NCBI Protein Information: protein Wnt-5a; WNT-5A protein
• UniProt Protein Name: Protein Wnt-5a
• UniProt Gene Name: WNT5A
• UniProt Entry Name: WNT5A_HUMAN

NCBI Description

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene encodes a member of the WNT family that signals through both the canonical and non-canonical WNT pathways. This protein is a ligand for the seven transmembrane receptor frizzled-5 and the tyrosine kinase orphan receptor 2. This protein plays an essential role in regulating developmental pathways during embryogenesis. This protein may also play a role in oncogenesis. Mutations in this gene are the cause of autosomal dominant Robinow syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012]

Uniprot Description

WNT5A: Ligand for members of the frizzled family of seven transmembrane receptors. Can activate or inhibit canonical Wnt signaling, depending on receptor context. In the presence of FZD4, activates beta-catenin signaling. In the presence of ROR2, inhibits the canonical Wnt pathway by promoting beta-catenin degradation through a GSK3-independent pathway which involves down-regulation of beta-catenin-induced reporter gene expression. Suppression of the canonical pathway allows chondrogenesis to occur and inhibits tumor formation. Stimulates cell migration. Decreases proliferation, migration, invasiveness and clonogenicity of carcinoma cells and may act as a tumor suppressor. Mediates motility of melanoma cells. Required during embryogenesis for extension of the primary anterior-posterior axis and for outgrowth of limbs and the genital tubercle. Inhibits type II collagen expression in chondrocytes. Interacts with PORCN. Interacts with WLS. Expression is increased in differentiated thyroid carcinomas compared to normal thyroid tissue and anaplastic thyroid tumors where expression is low or undetectable. Expression is found in thyrocytes but not in stromal cells. Belongs to the Wnt family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 3p21-p14

Cellular Component: proteinaceous extracellular matrix; extracellular space; cell surface; endoplasmic reticulum lumen; Golgi lumen; extracellular region; plasma membrane

Molecular Function: protein domain specific binding; receptor tyrosine kinase-like orphan receptor binding; frizzled binding; cytokine activity; receptor agonist activity; transcription factor activity; frizzled-2 binding

Biological Process: activation of MAPK activity; embryonic skeletal development; positive regulation of transcription, DNA-dependent; negative chemotaxis; positive regulation of interleukin-1 beta secretion; Wnt receptor signaling pathway through beta-catenin; negative regulation of synaptogenesis; uterus development; protein amino acid phosphorylation; negative regulation of BMP signaling pathway; activation of NF-kappaB transcription factor; neuron differentiation; positive regulation of fibroblast proliferation; determination of anterior/posterior axis, embryo; positive regulation of mesenchymal cell proliferation; positive regulation of macrophage activation; somitogenesis; cell fate commitment; urinary bladder development; olfactory bulb interneuron development; activation of protein kinase B; positive regulation of interleukin-6 production; vagina development; negative regulation of fat cell differentiation; keratinocyte differentiation; genitalia development; positive regulation of angiogenesis; Wnt receptor signaling pathway, calcium modulating pathway; positive regulation of protein catabolic process; midgut development; positive regulation of endothelial cell proliferation; positive regulation of transcription from RNA polymerase II promoter; embryonic digit morphogenesis; negative regulation of transcription, DNA-dependent; negative regulation of apoptosis; lens development in camera-type eye; axon guidance; wound healing; negative regulation of fibroblast growth factor receptor signaling pathway; hypophysis morphogenesis; positive regulation of cytokine secretion during immune response; palate development; negative regulation of axon extension involved in axon guidance; activation of JNK activity; response to organic substance; establishment of planar polarity; heart looping; negative regulation of epithelial cell proliferation; cervix development; Wnt receptor signaling pathway; positive regulation of meiosis; male gonad development; positive regulation of peptidyl-serine phosphorylation; positive regulation of ossification; positive regulation of cGMP metabolic process; positive regulation of interferon-gamma production; convergent extension involved in organogenesis; positive regulation of chemokine biosynthetic process; cartilage development; ameboidal cell migration; neural tube closure; epithelial to mesenchymal transition; hindgut morphogenesis; positive regulation of inflammatory response; lung development

Disease: Robinow Syndrome, Autosomal Dominant