Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE (SDS-Page analysis of recombinant human Wnt3a. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.)

Wnt-3a recombinant protein

Human Wnt-3a

Applications
No biological data available at the moment.
Purity
>90% by SDS-PAGE & Coomassie stain
Synonyms
Wnt-3a; Human Wnt-3a; Wnt-3a recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>90% by SDS-PAGE & Coomassie stain
Form/Format
Lyophilized
Sequence
Protein Sequence: MSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVA EGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIAS AGVAFAVTRSCAEGTAAICGHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEAS PNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCKLEHHHHHH
Sequence Length
352
Applicable Applications for Wnt-3a recombinant protein
No biological data available at the moment.
Stabilizer
None
Stability
The lyophilized human Wnt3a, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human Wnt3a should be stored in working aliquots at -20°C.
Reconstitution
Human Wnt3a should be reconstituted in 50 mM acetic acid to a concentration of 0.1 mg/ml. This is solution can be diluted in water or other buffer solutions or stored at -20°C.
Buffer
50mM acetic acid
Length (aa)
343

SDS-PAGE

(SDS-Page analysis of recombinant human Wnt3a. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.)

SDS-PAGE (SDS-Page analysis of recombinant human Wnt3a. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.)
Related Product Information for Wnt-3a recombinant protein
Wnt-3a is one of about 19 vertebrate members of the Wingless-type MMTV integration site (Wnt) family of highly conserved, cysteine-rich secreted glycoproteins important for normal developmental processes. Wnts bind to receptors of the Frizzled family in conjunction with a coreceptor of the low-density lipoprotein receptor-related protein family (LRP-5 or -6), or the Ryk atypical receptor tyrosine kinase. During development, Wnt-3a is a morphogen that is thought to coordinate somitogenesis and mesoderm boundary determination. When Wnt-3a is deleted, mice fail to develop a hippocampus, and show defects in anterior-posterior patterning, somite development and tailbud formation. Wnt-3a has also been implicated in chondrocyte differentiation. Like other Wnts, Wnt-3a is modified by palmitate addition (at Cys 77) following glycosylation, which increases its hydrophobicity, secretion and activity. A second site at Ser 209 modified by palmitoleic acid also contributes. Human Wnt-3a shares 96% amino acid (aa) identity with mouse, bovine and canine Wnt-3a, and 89%, 86% and 84% aa identity with chicken, Xenopus and zebrafish Wnt-3a, respectively. It also shares 87% aa identity with Wnt-3. Human Wnt-3a is a 44 kDa secreted hydrophobic glycoprotein containing a conserved pattern of 24 cysteine residues.
Product Categories/Family for Wnt-3a recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38.6 kDa
NCBI Official Full Name
protein Wnt-3a
NCBI Official Synonym Full Names
wingless-type MMTV integration site family, member 3A
NCBI Official Symbol
WNT3A
NCBI Protein Information
protein Wnt-3a
UniProt Protein Name
Protein Wnt-3a
Protein Family
UniProt Gene Name
WNT3A
UniProt Entry Name
WNT3A_HUMAN

NCBI Description

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 96% amino acid identity to mouse Wnt3A protein, and 84% to human WNT3 protein, another WNT gene product. This gene is clustered with WNT14 gene, another family member, in chromosome 1q42 region. [provided by RefSeq, Jul 2008]

Uniprot Description

WNT3A: Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube. Interacts with PORCN. Interacts with APCDD1 and WLS. Component of the Wnt-Fzd-LRP5-LRP6 signaling complex that contains a WNT protein, a FZD protein and LRP5 or LRP6. Interacts directly in the complex with LRP6. Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate. Belongs to the Wnt family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1q42

Cellular Component: proteinaceous extracellular matrix; extracellular space; cell surface; endoplasmic reticulum lumen; early endosome membrane; Golgi lumen; extracellular region; plasma membrane

Molecular Function: protein domain specific binding; protein binding; frizzled binding; transcription coactivator activity; receptor agonist activity; frizzled-2 binding

Biological Process: positive regulation of mesodermal cell fate specification; axon guidance; extracellular matrix organization and biogenesis; positive regulation of protein binding; positive regulation of transcription, DNA-dependent; cell proliferation in forebrain; positive regulation of receptor internalization; positive regulation of caspase activity; palate development; positive regulation of collateral sprouting in the absence of injury; Wnt receptor signaling pathway through beta-catenin; negative regulation of axon extension involved in axon guidance; Wnt receptor signaling pathway in forebrain neuroblast division; negative regulation of neurogenesis; neuron differentiation; mammary gland development; positive regulation of cell proliferation; positive regulation of B cell proliferation; hemopoiesis; heart looping; dorsoventral neural tube patterning; inner ear morphogenesis; in utero embryonic development; hippocampus development; negative regulation of fat cell differentiation; positive regulation of peptidyl-serine phosphorylation; osteoblast differentiation; paraxial mesodermal cell fate commitment; signalosome assembly; spinal cord association neuron differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; positive regulation of protein amino acid phosphorylation

Research Articles on Wnt-3a

Similar Products

Product Notes

The Wnt-3a wnt3a (Catalog #AAA692230) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Wnt-3a can be used in a range of immunoassay formats including, but not limited to, No biological data available at the moment. Researchers should empirically determine the suitability of the Wnt-3a wnt3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Protein Sequence: MSYPIWWSLA VGPQYSSLGS QPILCASIPG LVPKQLRFCR NYVEIMPSVA EGIKIGIQEC QHQFRGRRWN CTTVHDSLAI FGPVLDKATR ESAFVHAIAS AGVAFAVTRS CAEGTAAICG HMHLKCKCHG LSGSCEVKTC WWSQPDFRAI GDFLKDKYDS ASEMVVEKHR ESRGWVETLR PRYTYFKVPT ERDLVYYEAS PNFCEPNPET GSFGTRDRTC NVSSHGIDGC DLLCCGRGHN ARAERRREKC RCVFHWCCYV SCQECTRVYD VHTCKLEHHH HHH. It is sometimes possible for the material contained within the vial of "Wnt-3a, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.