Mouse anti-Human ETNK1 Monoclonal Antibody | anti-ETNK1 antibody

ETNK1 (Ethanolamine Kinase 1, EKI 1, EKI1, Nbla10396)

Cat. Num. AAA645281

• Gene Names: ETNK1; EKI; EKI1; EKI 1; Nbla10396
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ETNK1; Monoclonal Antibody; ETNK1 (Ethanolamine Kinase 1; EKI 1; EKI1; Nbla10396); Anti -ETNK1 (Ethanolamine Kinase 1; anti-ETNK1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1F3
• Specificity: Recognizes human ETNK1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: WDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFR

• Applicable Applications for anti-ETNK1 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa133-229 from human ETNK1 (NP_061108) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.67kD).)

Testing Data

(Detection limit for recombinant GST tagged ETNK1 is 1ng/ml as a capture antibody.)

Related Product Information for anti-ETNK1 antibody

Highly specific for ethanolamine phosphorylation. May be a rate-controlling step in phosphatidylethanolamine biosynthesis.

Product Categories/Family for anti-ETNK1 antibody

Antibodies; Abs to Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 211830645
• NCBI GeneID: 55500
• UniProt Accession #: Q9HBU6; G5E969
• Molecular Weight: 50,968 Da
• NCBI Official Full Name: ETNK1 protein
• NCBI Official Synonym Full Names: ethanolamine kinase 1
• NCBI Official Symbol: ETNK1
• NCBI Official Synonym Symbols: EKI; EKI1; EKI 1; Nbla10396
• NCBI Protein Information: ethanolamine kinase 1; putative protein product of Nbla10396
• UniProt Protein Name: Ethanolamine kinase 1
• Protein Family: Ethanolamine kinase
• UniProt Gene Name: ETNK1
• UniProt Synonym Gene Names: EKI1; EKI 1
• UniProt Entry Name: EKI1_HUMAN

NCBI Description

This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

ETNK1: Highly specific for ethanolamine phosphorylation. May be a rate-controlling step in phosphatidylethanolamine biosynthesis. Belongs to the choline/ethanolamine kinase family.

Protein type: EC 2.7.1.82; Kinase, other; Lipid Metabolism - glycerophospholipid

Chromosomal Location of Human Ortholog: 12p12.1

Cellular Component: nucleoplasm; membrane; cytoplasm; plasma membrane; cytosol

Molecular Function: ethanolamine kinase activity; ATP binding

Biological Process: phospholipid metabolic process; phosphatidylethanolamine biosynthetic process; glycerophospholipid biosynthetic process; phosphorylation