Acetylornithine aminotransferase, chloroplastic/mitochondrial (WIN1) Recombinant Protein | WIN1 recombinant protein
Recombinant Arabidopsis thaliana Acetylornithine aminotransferase, chloroplastic/mitochondrial (WIN1)
Gene Names
WIN1; HOPW1-1-interacting 1; T21F11.7; T21F11_7; TUMOR PRONE 5; TUP5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acetylornithine aminotransferase; chloroplastic/mitochondrial (WIN1); Recombinant Arabidopsis thaliana Acetylornithine aminotransferase; WIN1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
42-457, Full length protein
Sequence
VLTNAGDQAVSVKASVSQKVIEEEAKVIVGTYARAPVVLSSGKGCKLFDPEGKEYLDCASGIAVNALGHGDPDWLRAVTEQAGVLAHVSNVYYTIPQIELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHPEDKEVATGFIAFTNSFHGRTLGALALTSKEQYRTPFEPIMPGVTFLEYGNIQAATDLIRSGKIAAVFVEPIQGEGGIYSATKEFLQSLRSACDAAGSLLVFDEVQCGLGRTGLMWAYEAFGVTPDIMTVAKPLAGGLPIGAVLVTEKVAETINYGDHGSTFAGSPLVCSAAIAVMDKVSKPSFLSSVSNKGRYFRDLLVKKLGGNSHVKEVRGEGLIIGVELDVPASSLVDACRDSGLLILTAGKGNVVRIVPPLVISEEEIERAVEIMSQNLTALD
Sequence Length
416
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,827 Da
NCBI Official Full Name
HOPW1-1-interacting 1
NCBI Official Symbol
WIN1
NCBI Official Synonym Symbols
HOPW1-1-interacting 1; T21F11.7; T21F11_7; TUMOR PRONE 5; TUP5
NCBI Protein Information
HOPW1-1-interacting 1
UniProt Protein Name
Acetylornithine aminotransferase, chloroplastic/mitochondrial
Protein Family
UniProt Gene Name
WIN1
UniProt Synonym Gene Names
ACOAT; AOTA
NCBI Description
Encodes HopW1-1-Interacting protein 1 (WIN1). Interacts with the P. syringae effector HopW1-1. WIN1 is a putative acetylornithine transaminase. Modulates plant defenses against bacteria. Three WIN proteins are identified so far (WIN1: AT1G80600; WIN2: AT4G31750; WIN3: AT5G13320). Mediates red-light inhibition of seed germination.
Uniprot Description
Involved in the biosynthesis of citrulline (). Essential gene that modulates defense response to pathogenic bacteria, conferring susceptibility and repressing salicylic acid (SA) accumulation.
Research Articles on WIN1
Similar Products
Product Notes
The WIN1 win1 (Catalog #AAA1424424) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 42-457, Full length protein. The amino acid sequence is listed below: VLTNAGDQAV SVKASVSQKV IEEEAKVIVG TYARAPVVLS SGKGCKLFDP EGKEYLDCAS GIAVNALGHG DPDWLRAVTE QAGVLAHVSN VYYTIPQIEL AKRLVASSFA DRVFFCNSGT EANEAAIKFS RKFQRFTHPE DKEVATGFIA FTNSFHGRTL GALALTSKEQ YRTPFEPIMP GVTFLEYGNI QAATDLIRSG KIAAVFVEPI QGEGGIYSAT KEFLQSLRSA CDAAGSLLVF DEVQCGLGRT GLMWAYEAFG VTPDIMTVAK PLAGGLPIGA VLVTEKVAET INYGDHGSTF AGSPLVCSAA IAVMDKVSKP SFLSSVSNKG RYFRDLLVKK LGGNSHVKEV RGEGLIIGVE LDVPASSLVD ACRDSGLLIL TAGKGNVVRI VPPLVISEEE IERAVEIMSQ NLTALD. It is sometimes possible for the material contained within the vial of "Acetylornithine aminotransferase, chloroplastic/mitochondrial (WIN1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
