WD repeat-containing protein tag-125 (tag-125) Recombinant Protein | tag-125 recombinant protein

Recombinant Caenorhabditis elegans WD repeat-containing protein tag-125 (tag-125)

Cat. Num. AAA1487983

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: WD repeat-containing protein tag-125 (tag-125); Recombinant Caenorhabditis elegans WD repeat-containing protein tag-125 (tag-125); tag-125 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-376, Full length
• Sequence: MDTSENAASAAEQQPTQQIDQLTVPNAPDGGSSAPAPSTSPNSISPSNPTGTPAPGASAQTPNPNAAGASASGSANYKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQPVLASDCHPVQNIIASGALEPDNKIHIWRSDV
• Sequence Length: 376

• Species: Caenorhabditis elegans
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 17552164
• NCBI GeneID: 175474
• NCBI Accession #: NP_497749.1
• NCBI GenBank Nucleotide #: NM_065348.7
• UniProt Accession #: Q17963
• Molecular Weight: 40,393 Da
• NCBI Official Full Name: WD repeat-containing protein wdr-5.1
• NCBI Official Symbol: wdr-5.1
• NCBI Protein Information: WD repeat-containing protein wdr-5.1
• UniProt Protein Name: WD repeat-containing protein wdr-5.1
• Protein Family: WD repeat-containing protein
• UniProt Gene Name: wdr-5.1
• UniProt Synonym Gene Names: swd-3.1; tag-125

Uniprot Description

Contributes to histone modification (PubMed:16710447, PubMed:17967446, PubMed:20188723, PubMed:20555324, PubMed:21455483, PubMed:22012258). May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4' (PubMed:21455483). Required for di- and trimethylation, particularly for the trimethylation at 'Lys-4' of histone H3 (PubMed:20555324, PubMed:21455483, PubMed:24682813, PubMed:21527717). Not required for demethylation of histone H3 'Lys-27' (PubMed:21455483). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation, germline establishment, maintenance and function (PubMed:21455483). Implicated in the epigenetic inheritance of lifespan over several generations (PubMed:22012258). Acts in the germline to limit the longevity of the soma, probably by regulating a lipid metabolism pathway that signals from the germline to the intestine, thereby preventing accumulation of mono-unsaturated fatty acids (PubMed:17967446, PubMed:20555324, PubMed:28379943). Required for RNA interference with probable antagonistic role against hpl-2 function (PubMed:17967446). Plays a role in vulval cell fate specification by acting in the synthetic multivulva pathway independent of set-2 (PubMed:17967446). Sex determining protein required in the germline to promote the spermatogenesis to oogenesis switch during the late larval stages of development (PubMed:24682813). Acts with the sex determining factor tra-1, and redundantly with wdr-5.2, to regulate fog-3 expression, which in turn determines germ cell fate (PubMed:24682813). Cooperates with jmjd-3.1, egl-27 and unc-3 to ensure robust transdifferentiation of the Y rectal cell to the PDA motor neuron during larval development (PubMed:25124442).