Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE ()

Rotavirus VP6 Recombinant Protein

Rotavirus VP6 protein (His tag)

Purity
> 90% pure
Synonyms
Rotavirus VP6; Rotavirus VP6 protein (His tag); Glycoprotein VP6 protein; Rotavirus protein; VP6 protein; Intermediate capsid protein VP6; Rotavirus VP6 recombinant protein
Ordering
For Research Use Only!
Host
Human
Purity/Purification
> 90% pure
Form/Format
Supplied lyophilized in 10 mM Tris-HCl, pH 8.0, 1 mM EDTA with 6% Trehalose. Reconstitute with sterile laboratory grade water to a concentration of 0.1 to 1mg/ml and use immediately. For longer term storage in liquid form, add glycerol @ 5 to 50% final co
Concentration
1.0mg/ml (varies by lot)
Sequence
MEVLYSLSKTLKDARDKIVEGTLYSNVSDLIQQFNQMIVTMNGNDFQ TGGIGNLPIRNWTFDFGLLGTTLLNLDANYVETARTTIEYFIDFIDNVC MDEMARESQRNGVAPQSEALRKLAGIKFKRINFNNSSEYIENWNLQN RRQRTGFVFHKPNIFPYSASFTLNRSQPMHDNLMGTMWLNAGSEIQV AGFDYSCALNAPANIQQFEHIVQLRRALTTATITLLPDAERFSFPRVIN SADGATTWFFNPIILRPNNVEVEFLLNGQIINTYQARFGTIIARNFDTIR LSFQLMRPPNMTPAVNALFPQAQPFQHHATVGLTLRIESAVCESVLAD ANETLLANVTAVRQEYAIPVGPVFPPGMNWTELITNYSPSREDNLQRV FTVASIRSMLIK
Protein Type
Recombinant
Biological Significance
Rotaviruses belong to the family of Reoviridae, and complete viral particles have a triple-layered icosahedral protein capsid that surrounds the genome of 11 segments of double-stranded RNA, which encode six structural proteins and six nonstructural protein.
Expression System
E Coli
Tag/Conjugate
His tag
Preparation and Storage
Ships at 4 degree C. Upon receipt store at -20 degree C to -80 degree C. Recommended shelf life is1 year in the lyophilized format. Once reconstituted use within 6 months of reconstitution. Avoid repeated freeze thaws of reconstituted product.

SDS-PAGE

()

SDS-PAGE ()
Related Product Information for Rotavirus VP6 recombinant protein
Purified recombinant Rotavirus VP6 protein (His tag)
Product Categories/Family for Rotavirus VP6 recombinant protein

Similar Products

Product Notes

The Rotavirus VP6 (Catalog #AAA5304627) is a Recombinant Protein produced from Human and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MEVLYSLSKT LKDARDKIVE GTLYSNVSDL IQQFNQMIVT MNGNDFQ TGGIGNLPIR NWTFDFGLLG TTLLNLDANY VETARTTIEY FIDFIDNVC MDEMARESQR NGVAPQSEAL RKLAGIKFKR INFNNSSEYI ENWNLQN RRQRTGFVFH KPNIFPYSAS FTLNRSQPMH DNLMGTMWLN AGSEIQV AGFDYSCALN APANIQQFEH IVQLRRALTT ATITLLPDAE RFSFPRVIN SADGATTWFF NPIILRPNNV EVEFLLNGQI INTYQARFGT IIARNFDTIR LSFQLMRPPN MTPAVNALFP QAQPFQHHAT VGLTLRIESA VCESVLAD ANETLLANVT AVRQEYAIPV GPVFPPGMNW TELITNYSPS REDNLQRV FTVASIRSML IK. It is sometimes possible for the material contained within the vial of "Rotavirus VP6, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.