WD repeat and FYVE domain-containing protein 2 (WDFY2) Recombinant Protein | WDFY2 recombinant protein

Recombinant Human WD repeat and FYVE domain-containing protein 2 (WDFY2)

Cat. Num. AAA1394201

• Gene Names: WDFY2; PROF; WDF2; ZFYVE22
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: WD repeat and FYVE domain-containing protein 2 (WDFY2); Recombinant Human WD repeat and FYVE domain-containing protein 2 (WDFY2); WDFY2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-400, Full length protein
• Sequence: MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEEGVISVSEDRTVRVWLKRDSGQYWPSVYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS
• Sequence Length: 400

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for WDFY2 recombinant protein

This gene encodes a protein that contains two WD domains and an FYVE zinc finger region. The function of this gene is unknown. An alternatively spliced transcript variant of this gene may exist.

NCBI and Uniprot Product Information

• NCBI GI #: 16418439
• NCBI GeneID: 115825
• NCBI Accession #: NP_443182.1
• NCBI GenBank Nucleotide #: NM_052950.3
• UniProt Accession #: Q96P53; Q96CS1; B1AL86
• Molecular Weight: 45,154 Da
• NCBI Official Full Name: WD repeat and FYVE domain-containing protein 2
• NCBI Official Synonym Full Names: WD repeat and FYVE domain containing 2
• NCBI Official Symbol: WDFY2
• NCBI Official Synonym Symbols: PROF; WDF2; ZFYVE22
• NCBI Protein Information: WD repeat and FYVE domain-containing protein 2
• UniProt Protein Name: WD repeat and FYVE domain-containing protein 2
• UniProt Gene Name: WDFY2
• UniProt Synonym Gene Names: WDF2; ZFYVE22; Prof

NCBI Description

This gene encodes a protein that contains two WD domains and an FYVE zinc finger region. The function of this gene is unknown. An alternatively spliced transcript variant of this gene may exist. [provided by RefSeq, Jul 2008]

Uniprot Description

Acts in an adapter protein-like fashion to mediate the interaction between the kinase PRKCZ and its substrate VAMP2 and increases the PRKCZ-dependent phosphorylation of VAMP2 (PubMed:17313651). Positively regulates adipocyte differentiation, by facilitating the phosphorylation and thus inactivation of the anti-adipogenetic transcription factor FOXO1 by the kinase AKT1 (PubMed:18388859). Plays a role in endosomal control of AKT2 signaling; required for insulin-stimulated AKT2 phosphorylation and glucose uptake and insulin-stimulated phosphorylation of AKT2 substrates (). Participates in transferrin receptor endocytosis (PubMed:16873553).