Mouse anti-Human WDFY2 Polyclonal Antibody | anti-WDFY2 antibody

WDFY2 (WD Repeat and FYVE Domain-containing Protein 2, WD40- and FYVE Domain-containing Protein 2, WDF2, Zinc Finger FYVE Domain-containing Protein 22, ZFYVE22, PROF, RP11-147H23.1)

Cat. Num. AAA6011776

• Gene Names: WDFY2; PROF; WDF2; ZFYVE22; RP11-147H23.1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: WDFY2; Polyclonal Antibody; WDFY2 (WD Repeat and FYVE Domain-containing Protein 2; WD40- and FYVE Domain-containing Protein 2; WDF2; Zinc Finger FYVE Domain-containing Protein 22; ZFYVE22; PROF; RP11-147H23.1); Anti -WDFY2 (WD Repeat and FYVE Domain-containing Protein 2; anti-WDFY2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human WDFY2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEEGVISVSEDRTVRVWLKRDSGQYWPSVYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS

• Applicable Applications for anti-WDFY2 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human WDFY2, aa1-400 (NP_443182.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of WDFY2 expression in transfected 293T cell line by WDFY2 polyclonal antibody. Lane 1: WDFY2 transfected lysate (44kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-WDFY2 antibody

Antibodies; Abs to WD Repeat Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 16418439
• NCBI GeneID: 115825
• NCBI Accession #: NP_443182.1
• NCBI GenBank Nucleotide #: NM_052950.3
• UniProt Accession #: Q96P53; Q96CS1; B1AL86
• Molecular Weight: 45,154 Da
• NCBI Official Full Name: WD repeat and FYVE domain-containing protein 2
• NCBI Official Synonym Full Names: WD repeat and FYVE domain containing 2
• NCBI Official Symbol: WDFY2
• NCBI Official Synonym Symbols: PROF; WDF2; ZFYVE22; RP11-147H23.1
• NCBI Protein Information: WD repeat and FYVE domain-containing protein 2; propeller-FYVE protein; WD40 and FYVE domain containing 2; WD40- and FYVE domain-containing protein 2; zinc finger FYVE domain-containing protein 22
• UniProt Protein Name: WD repeat and FYVE domain-containing protein 2
• UniProt Gene Name: WDFY2
• UniProt Synonym Gene Names: WDF2; ZFYVE22
• UniProt Entry Name: WDFY2_HUMAN

NCBI Description

This gene encodes a protein that contains two WD domains and an FYVE zinc finger region. The function of this gene is unknown. An alternatively spliced transcript variant of this gene may exist. [provided by RefSeq, Jul 2008]

Uniprot Description

WDFY2: a PI3P-binding, FYVE domain-containing protein that localizes to a distinct subset of early endosomes located close to the plasma membrane. WDFY2-enriched endosomes enable insulin signaling through Akt2. WDFY2 localizes with endogenous Akt2 but not Akt1. Depletion of WDFY2 leads to a reduction of Akt2 but not Akt1 protein levels, decreased Akt phosphorylation, and decreased insulin-stimulated phosphorylation of numerous Akt substrates

Chromosomal Location of Human Ortholog: 13q14.3

Molecular Function: metal ion binding