Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE (SDS-page of N-terminal His-tag for Yeast Derived)

Phosphatidylinositol 3-kinase VPS34 (VPS34) Recombinant Protein | VPS34 recombinant protein

Recombinant Saccharomyces cerevisiae Phosphatidylinositol 3-kinase VPS34 (VPS34) , partial

Gene Names
VPS34; END12; PEP15; STT8; VPL7; VPS7; VPT29
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphatidylinositol 3-kinase VPS34 (VPS34); Recombinant Saccharomyces cerevisiae Phosphatidylinositol 3-kinase VPS34 (VPS34); partial; VPS34 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
619-873aa; PI3K/PI4K domain
Sequence
YHLMFKVGDDLRQDQLVVQIISLMNELLKNENVDLKLTPYKILATGPQEGAIEFIPND TLASILSKYHGILGYLKLHYPDENATLGVQGWVLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFG YILGQDPKPFPPLMKLPPQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAILR VRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYW
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

(SDS-page of N-terminal His-tag for Yeast Derived)

SDS-PAGE (SDS-page of N-terminal His-tag for Yeast Derived)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
100,921 Da
NCBI Official Full Name
phosphatidylinositol 3-kinase VPS34
NCBI Official Symbol
VPS34
NCBI Official Synonym Symbols
END12; PEP15; STT8; VPL7; VPS7; VPT29
NCBI Protein Information
phosphatidylinositol 3-kinase VPS34
UniProt Protein Name
Phosphatidylinositol 3-kinase VPS34
UniProt Gene Name
VPS34
UniProt Synonym Gene Names
END12; PEP15; VPL7; VPT29; PI3-kinase VPS34; PI3K VPS34; PtdIns-3-kinase VPS34

Uniprot Description

Phosphatidylinositol 3-kinase required for cytoplasm to vacuole transport (Cvt) and autophagy as a part of the autophagy-specific VPS34 PI3-kinase complex I. This complex is essential to recruit the ATG8-phosphatidylinositol conjugate and the ATG12-ATG5 conjugate to the pre-autophagosomal structure. Also involved in endosome-to-Golgi retrograde transport as part of the VPS34 PI3-kinase complex II. This second complex is required for the endosome-to-Golgi retrieval of PEP1 and KEX2, and the recruitment of VPS5 and VPS7, two components of the retromer complex, to endosomal membranes (probably through the synthesis of a specific pool of phosphatidylinositol 3-phosphate recruiting the retromer to the endosomes). Its activation by VPS15 may lead to the phosphorylation of phosphatidylinositol in the sorting compartment membrane. Finally, it might also be involved in ethanol tolerance and cell wall integrity.

Research Articles on VPS34

Similar Products

Product Notes

The VPS34 vps34 (Catalog #AAA1138476) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 619-873aa; PI3K/PI4K domain. The amino acid sequence is listed below: YHLMFKVGDD LRQDQLVVQI ISLMNELLKN ENVDLKLTPY KILATGPQEG AIEFIPND TLASILSKYH GILGYLKLHY PDENATLGVQ GWVLDNFVKS CAGYCVITYI LGVGDRHLDN LLVTPDGHFF HADFG YILGQDPKPF PPLMKLPPQI IEAFGGAESS NYDKFRSYCF VAYSILRRNA GLILNLFELM KTSNIPDIRI DPNGAILR VRERFNLNMS EEDATVHFQN LINDSVNALL PIVIDHLHNL AQYW. It is sometimes possible for the material contained within the vial of "Phosphatidylinositol 3-kinase VPS34 (VPS34), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.