Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Selenoprotein S (SELS) Recombinant Protein | VIMP recombinant protein

Recombinant Pig Selenoprotein S (SELS)

Gene Names
VIMP; SELS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Selenoprotein S (SELS); Recombinant Pig Selenoprotein S (SELS); Recombinant Selenoprotein S (SELS); Selenoprotein S; SelS; VIMP recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-190
Sequence
MEQDGDQLSARPALETEGLRFLHVTVGSLLATYGWYIVFCCILLYVVFQKLSTRLRALRQRHLDGAAAALEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLRQLEEEKRRQKIERWDSVQEGRSYRGDARKRQEEDSPGPSTSSVIPKRKSDKKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG
Sequence Length
190
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,279 Da
NCBI Official Full Name
selenoprotein S
NCBI Official Symbol
VIMP
NCBI Official Synonym Symbols
SELS
NCBI Protein Information
selenoprotein S
UniProt Protein Name
Selenoprotein S
Protein Family
UniProt Gene Name
VIMP
UniProt Synonym Gene Names
SELS; SelS
UniProt Entry Name
SELS_PIG

Uniprot Description

Function: Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Probably acts by serving as a linker between DERL1, which mediates the retrotranslocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination

By similarity. UniProtKB Q9BQE4

Subunit structure: Interacts with DERL1 and VCP, suggesting that it forms a membrane complex with DERL1 that serves as a receptor for VCP

By similarity. UniProtKB Q9BQE4

Subcellular location: Cytoplasm. Endoplasmic reticulum membrane; Single-pass membrane protein

By similarity Ref.1 UniProtKB Q9BQE4.

Tissue specificity: Ubiquitously expressed. Highest expression in liver and lung, with lower levels detected in spleen, kidney, brain, lymph nodes, small intestine, stomach and heart. Very low expression detected in longissimus dorsi. Ref.1

Sequence similarities: Belongs to the selenoprotein S family.

Sequence caution: The sequence CU467921 differs from that shown. Reason: Erroneous termination at position 189. Translated as Sec.

Similar Products

Product Notes

The VIMP vimp (Catalog #AAA1058024) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-190. The amino acid sequence is listed below: MEQDGDQLSA RPALETEGLR FLHVTVGSLL ATYGWYIVFC CILLYVVFQK LSTRLRALRQ RHLDGAAAAL EPDVVVKRQE ALAAARLKMQ EELNAQVEKH KEKLRQLEEE KRRQKIERWD SVQEGRSYRG DARKRQEEDS PGPSTSSVIP KRKSDKKPLR GGGYNPLSGE GGGACSWRPG RRGPSSGGUG. It is sometimes possible for the material contained within the vial of "Selenoprotein S (SELS), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.