Mitochondrial outer membrane protein porin 3 (VDAC3) Recombinant Protein | VDAC3 recombinant protein
Recombinant Arabidopsis thaliana Mitochondrial outer membrane protein porin 3 (VDAC3)
Gene Names
VDAC3; ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 3; ATVDAC3; F2G14.210; F2G14_210; voltage dependent anion channel 3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial outer membrane protein porin 3 (VDAC3); Recombinant Arabidopsis thaliana Mitochondrial outer membrane protein porin 3 (VDAC3); VDAC3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-274, Full length protein
Sequence
VKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQVKNNNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTSVGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGEKLNASYYQIVSPSTVVGAEISHNFTTKENAITVGTQHALDPLTTVKARVNNAGVANALIQHEWRPKSFFTVSGEVDSKAIDKSAKVGIALALKP
Sequence Length
273
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,211 Da
NCBI Official Full Name
voltage dependent anion channel 3
NCBI Official Symbol
VDAC3
NCBI Official Synonym Symbols
ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 3; ATVDAC3; F2G14.210; F2G14_210; voltage dependent anion channel 3
NCBI Protein Information
voltage dependent anion channel 3
UniProt Protein Name
Mitochondrial outer membrane protein porin 3
Protein Family
UniProt Gene Name
VDAC3
UniProt Synonym Gene Names
HSR2; Athsr2; AtVDAC3; VDAC-3
NCBI Description
Encodes a voltage-dependent anion channel (VDAC: AT3G01280/VDAC1, AT5G67500/VDAC2, AT5G15090/VDAC3, AT5G57490/VDAC4, AT5G15090/VDAC5). VDACs are reported to be porin-type, beta-barrel diffusion pores. They are prominently localized in the outer mitochondrial membrane and are involved in metabolite exchange between the organelle and the cytosol.
Uniprot Description
Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective ().
Research Articles on VDAC3
Similar Products
Product Notes
The VDAC3 vdac3 (Catalog #AAA1304711) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-274, Full length protein. The amino acid sequence is listed below: VKGPGLYTEI GKKARDLLYR DYQGDQKFSV TTYSSTGVAI TTTGTNKGSL FLGDVATQVK NNNFTADVKV STDSSLLTTL TFDEPAPGLK VIVQAKLPDH KSGKAEVQYF HDYAGISTSV GFTATPIVNF SGVVGTNGLS LGTDVAYNTE SGNFKHFNAG FNFTKDDLTA SLILNDKGEK LNASYYQIVS PSTVVGAEIS HNFTTKENAI TVGTQHALDP LTTVKARVNN AGVANALIQH EWRPKSFFTV SGEVDSKAID KSAKVGIALA LKP. It is sometimes possible for the material contained within the vial of "Mitochondrial outer membrane protein porin 3 (VDAC3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
