Protein UXT (UXT) Recombinant Protein | UXT recombinant protein

Recombinant Human Protein UXT (UXT)

Cat. Num. AAA1422044

• Gene Names: UXT; STAP1; ART-27
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein UXT (UXT); Recombinant Human Protein UXT (UXT); UXT recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-157, Full length protein
• Sequence: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
• Sequence Length: 157

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for UXT recombinant protein

This gene encodes a novel protein which is highly conserved in mouse. It interacts with the N-terminus of the androgen receptor and plays a role in facilitating receptor-induced transcriptional activation. It is also likely to be involved in tumorigenesis as it is abundantly expressed in tumor tissues. This gene is part of a gene cluster on chromosome Xp11.23. Alternative splicing results in 2 transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

• NCBI GI #: 4759298
• NCBI GeneID: 8409
• NCBI Accession #: NP_004173.1
• NCBI GenBank Nucleotide #: NM_004182.3
• UniProt Accession #: Q9UBK9; Q5JZG3; Q9Y6E5; A0A0C4DFR8; B2R561
• Molecular Weight: 19,597 Da
• NCBI Official Full Name: protein UXT isoform 2
• NCBI Official Synonym Full Names: ubiquitously expressed prefoldin like chaperone
• NCBI Official Symbol: UXT
• NCBI Official Synonym Symbols: STAP1; ART-27
• NCBI Protein Information: protein UXT
• UniProt Protein Name: Protein UXT
• Protein Family: Protein
• UniProt Gene Name: UXT
• UniProt Synonym Gene Names: ART-27

NCBI Description

The protein encoded by this gene functions as a cofactor that modulates androgen receptor-dependent transcription, and also plays a critical role in tumor necrosis factor-induced apoptosis. Expression of this gene may play a role in tumorigenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

Involved in gene transcription regulation (PubMed:28106301, PubMed:21730289). Acts in concert with the corepressor URI1 to regulate androgen receptor AR-mediated transcription (PubMed:11854421, PubMed:21730289). Together with URI1, associates with chromatin to the NKX3-1 promoter region (PubMed:21730289). Negatively regulates the transcriptional activity of the estrogen receptor ESR1 by inducing its translocation into the cytoplasm (PubMed:28106301). May act as nuclear chaperone that facilitates the formation of the NF-kappa-B enhanceosome and thus positively regulates NF-kappa-B transcription activity (PubMed:17620405, PubMed:21307340). Potential component of mitochondrial-associated LRPPRC, a multidomain organizer that potentially integrates mitochondria and the microtubular cytoskeleton with chromosome remodeling (PubMed:17554592). Increasing concentrations of UXT contributes to progressive aggregation of mitochondria and cell death potentially through its association with LRPPRC (PubMed:17554592). Suppresses cell transformation and it might mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like MECOM (PubMed:17635584).