Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Nuclear egress membrane protein (UL50) Recombinant Protein | UL50 recombinant protein

Recombinant Human cytomegalovirus Nuclear egress membrane protein (UL50)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nuclear egress membrane protein (UL50); Recombinant Human cytomegalovirus Nuclear egress membrane protein (UL50); Recombinant Nuclear egress membrane protein (UL50); Nuclear egress membrane protein; Primary envelopment factor UL50 Protein HFLF4; UL50 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-397
Sequence
MEMNKVLHQDLVQATRRILKLGPSELRVTDAGLICKNPNYSVCDAMLKTDTVYCVEYLLSYWESRTDHVPCFIFKNTGCAVSLCCFVRAPVKLVSPARHVGEFNVLKVNESLIVTLKDIEEIKPSAYGVLTKCVVRKSNSASVFNIELIAFGPENEGEYENLLRELYAKKAASTSLAVRNHVTVSSHSGSGPSLWRARMSAALTRTAGKRSSRTASPPPPPRHPSCSPTMVAAGGAAAGPRPPPPPMAAGSWRLCRCEACMGRCGCASEGDADEEEEELLALAGEGKAAAAAAGQDVGGSARRPLEEHVSRRRGVSTHHRHPPSPPCAPSLERTGYRWAPSSWWRARSGPSRPQSGPWLPARFATLGPLVLALLLVLALLWRGHGQSSSPTRSAHRD
Sequence Length
397
Species
Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
42,901 Da
NCBI Official Full Name
Nuclear egress membrane protein
UniProt Protein Name
Nuclear egress membrane protein
UniProt Gene Name
UL50
UniProt Entry Name
UL50_HCMVA

Uniprot Description

Function: Plays a major role in virion nuclear egress, the first step of virion release from infected cell. Viral capsids are initially assembled within the nucleus, UL53/UL50 complex induces capsids budding and envelopment into the perinuclear space. Then UL53/UL50 complex promotes fusion of perinuclear virion envelope with the outer nuclear membrane, releasing viral capsid into the cytoplasm where it will engages budding sites in the Golgi or trans-Golgi network

By similarity.

Subunit structure: Forms a complex with UL50

By similarity.

Subcellular location: Host nucleus inner membrane; Single-pass membrane protein. Note: Localizes also at the transient membrane of perinuclear virions

By similarity.

Sequence similarities: Belongs to the herpesviridae UL34 family.

Similar Products

Product Notes

The Nuclear egress membrane protein (UL50) ul50 (Catalog #AAA1052184) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-397. The amino acid sequence is listed below: MEMNKVLHQD LVQATRRILK LGPSELRVTD AGLICKNPNY SVCDAMLKTD TVYCVEYLLS YWESRTDHVP CFIFKNTGCA VSLCCFVRAP VKLVSPARHV GEFNVLKVNE SLIVTLKDIE EIKPSAYGVL TKCVVRKSNS ASVFNIELIA FGPENEGEYE NLLRELYAKK AASTSLAVRN HVTVSSHSGS GPSLWRARMS AALTRTAGKR SSRTASPPPP PRHPSCSPTM VAAGGAAAGP RPPPPPMAAG SWRLCRCEAC MGRCGCASEG DADEEEEELL ALAGEGKAAA AAAGQDVGGS ARRPLEEHVS RRRGVSTHHR HPPSPPCAPS LERTGYRWAP SSWWRARSGP SRPQSGPWLP ARFATLGPLV LALLLVLALL WRGHGQSSSP TRSAHRD. It is sometimes possible for the material contained within the vial of "Nuclear egress membrane protein (UL50), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.