Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Ubiquitin-conjugating enzyme E2 D2B (Ube2d2b) Recombinant Protein | Ube2d2b recombinant protein

Recombinant Rat Ubiquitin-conjugating enzyme E2 D2B (Ube2d2b)

Gene Names
Ube2d4; Ube2d2; Ube2d2b; RGD69425
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ubiquitin-conjugating enzyme E2 D2B (Ube2d2b); Recombinant Rat Ubiquitin-conjugating enzyme E2 D2B (Ube2d2b); Ube2d2b recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-147, full length protein
Sequence
MALKRIHKELNDLAQDPPAQCSAGPVGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTEYPFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVLLSISSLLCDPNPDDPLVPEIAQIYKTDRDKYNRTAREWTQKYAM
Sequence Length
147
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,659 Da
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 D2B
NCBI Official Synonym Full Names
ubiquitin-conjugating enzyme E2D 4 (putative)
NCBI Official Symbol
Ube2d4
NCBI Official Synonym Symbols
Ube2d2; Ube2d2b; RGD69425
NCBI Protein Information
ubiquitin-conjugating enzyme E2 D2B
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 D2B
UniProt Gene Name
Ube2d2b
UniProt Synonym Gene Names
Ube2d2

NCBI Description

ubiquitin-conjugating enzyme (E2 class); mediates the targeting of abnormal and short-lived proteins for degradation [RGD, Feb 2006]

Uniprot Description

Catalyzes the covalent attachment of ubiquitin to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and autoubiquitination of STUB1 and TRAF6. Involved in the signal-induced conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53 and the activation of MAVS in the mitochondria by DDX58/RIG-I in response to viral infection Plays a role in early maturation of the testis.

Similar Products

Product Notes

The Ube2d2b ube2d2b (Catalog #AAA1075466) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-147, full length protein. The amino acid sequence is listed below: MALKRIHKEL NDLAQDPPAQ CSAGPVGEDM FHWQATIMGP NDSPYQGGAF FLTIDFPTEY PFKPPKVEFT TRIYHPNVNS NGSICLDILR SQWSPALTIS KVLLSISSLL CDPNPDDPLV PEIAQIYKTD RDKYNRTARE WTQKYAM. It is sometimes possible for the material contained within the vial of "Ubiquitin-conjugating enzyme E2 D2B (Ube2d2b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.