SDS-Page
Transthyretin (Ttr) Recombinant Protein | Ttr recombinant protein
Recombinant Mouse Transthyretin (Ttr), partial
Gene Names
Ttr; D17860; AA408768; AI787086; prealbumin
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transthyretin (Ttr); Recombinant Mouse Transthyretin (Ttr); partial; Prealbumin; Ttr recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-147aa; Partial
Sequence
AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQ
Organism
Mus musculus (Mouse)
Tag Information
N-terminal 6xHis-SUMO-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
SDS-Page
SDS-Page
Related Product Information for Ttr recombinant protein
Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
Product Categories/Family for Ttr recombinant protein
References
"Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides." Bernhard O.K., Kapp E.A., Simpson R.J.J. Proteome Res. 6:987-995 (2007)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29.5 kDa
NCBI Official Full Name
transthyretin
NCBI Official Synonym Full Names
transthyretin
NCBI Official Symbol
Ttr
NCBI Official Synonym Symbols
D17860; AA408768; AI787086; prealbumin
NCBI Protein Information
transthyretin
UniProt Protein Name
Transthyretin
Protein Family
UniProt Gene Name
Ttr
NCBI Description
This gene encodes a carrier protein responsible for the transport of thyroid hormones and retinol. The protein consists of a tetramer of identical subunits. Due to increased stability of the tetramer form of this encoded protein in mouse, compared to the human protein, this gene product has a reduced tendency to form amyloid fibrils. In humans, this protein binds beta-amyloid preventing its aggregation and providing a neuroprotective role in Alzheimer's disease. [provided by RefSeq, Mar 2010]
Uniprot Description
Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
Research Articles on Ttr
Similar Products
Product Notes
The Ttr ttr (Catalog #AAA7110896) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-147aa; Partial with tag N-terminal 6xHis-SUMO-tagged. The amino acid sequence is listed below: AGAGESKCPL MVKVLDAVRG SPAVDVAVKV FKKTSEGSWE PFASGKTAES GELHGLTTDE KFVEGVYRVE LDTKSYWKTL GISPFHEFAD VVFTANDSGH RHYTIAALLS PYSYSTTAVV SNPQ . It is sometimes possible for the material contained within the vial of "Transthyretin (Ttr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
