Mouse anti-Human ARID3A Monoclonal Antibody | anti-ARID3A antibody

ARID3A (AT-rich Interactive Domain-containing Protein 3A, ARID Domain-containing Protein 3A, B Cell Regulator of IgH Transcription, Bright, Dead Ringer-like Protein 1, E2F-binding Protein 1, DRIL1, DRIL3, DRX, E2FBP1) (HRP)

Cat. Num. AAA6151268

• Gene Names: ARID3A; DRIL1; DRIL3; BRIGHT; E2FBP1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ARID3A; Monoclonal Antibody; ARID3A (AT-rich Interactive Domain-containing Protein 3A; ARID Domain-containing Protein 3A; B Cell Regulator of IgH Transcription; Bright; Dead Ringer-like Protein 1; E2F-binding Protein 1; DRIL1; DRIL3; DRX; E2FBP1) (HRP); anti-ARID3A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A11
• Specificity: Recognizes human ARID3A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-ARID3A antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa317-416 from human ARID3A (NP_005215) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(ARID3A monoclonal antibody, Western Blot analysis of ARID3A expression in K-562.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ARID3A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ARID3A on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ARID3A is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of ARID3A over-expressed 293 cell line, cotransfected with ARID3A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARID3A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-ARID3A antibody

Antibodies; Binding Proteins

References

1. Expression profiling of more than 3500 proteins of MSS-type colorectal cancer by stable isotope labeling and mass spectrometry. Kang UB, Yeom J, Kim HJ, Kim H, Lee C.J Proteomics. 2011 Nov 26.

NCBI and Uniprot Product Information

• NCBI GI #: 4885193
• NCBI GeneID: 1820
• NCBI Accession #: NP_005215
• NCBI GenBank Nucleotide #: NM_005224
• UniProt Accession #: Q99856; Q5I858; Q6P9C6; Q8IZA7; Q8N4Z3
• Molecular Weight: 62,889 Da
• NCBI Official Full Name: AT-rich interactive domain-containing protein 3A
• NCBI Official Synonym Full Names: AT rich interactive domain 3A (BRIGHT-like)
• NCBI Official Symbol: ARID3A
• NCBI Official Synonym Symbols: DRIL1; DRIL3; BRIGHT; E2FBP1
• NCBI Protein Information: AT-rich interactive domain-containing protein 3A; ARID domain-containing 3A; ARID domain-containing protein 3A; AT rich interactive domain 3A (BRIGHT- like) protein; B-cell regulator of IgH transcription; E2F-binding protein 1; dead ringer-like 1; dead ri
• UniProt Protein Name: AT-rich interactive domain-containing protein 3A
• Protein Family: AT-rich interactive domain-containing protein
• UniProt Gene Name: ARID3A
• UniProt Synonym Gene Names: DRIL1; DRIL3; DRX; E2FBP1; ARID domain-containing protein 3A; Bright
• UniProt Entry Name: ARI3A_HUMAN

Uniprot Description

Bright: a member of the ARID (AT-rich interaction domain) family of transcription factors. It was found by its homology to the Drosophila dead ringer protein, which is important for normal embryogenesis. Binds a VH promoter proximal site necessary for induced mu-heavy-chain transcription. Binds the minor groove of a restricted ATC sequence that is sufficient for nuclear matrix association. This sequence motif is present in matrix-associating regions (MARS) proximal to the promoter and flanking E mu. Activates E mu-driven transcription by binding these sites. Contributes to localized control of accessibility and therefore nonrandom gene use during V(D)J recombination.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: nucleoplasm; Golgi apparatus; cytoplasm; nucleolus; lipid raft

Molecular Function: protein binding; protein homodimerization activity; chromatin binding

Biological Process: transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter