Pachytene checkpoint protein 2 homolog (TRIP13) Recombinant Protein | TRIP13 recombinant protein
Recombinant Chicken Pachytene checkpoint protein 2 homolog (TRIP13)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pachytene checkpoint protein 2 homolog (TRIP13); Recombinant Chicken Pachytene checkpoint protein 2 homolog (TRIP13); TRIP13 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-432, Full length protein
Sequence
MDEAAGDLKQALPNTCDNVQIHVEVHQKSNSTAKKEDIRMSVLKLLNRHNIVFGDYKWTEFDDGFLNSNVQSVSIVDTELKLKERQPIDLSKSSLTIHIFHLNEEGPSIENLEEENEDIVAANHWVLPAAEFHGLWESLIYDTEVKSHLLDYVTTTLLFSDRNVDSNLISWNRVVLLHGPPGTGKTSLCKALAQKLTIRLSYRYRYGQLIEINSHSLFSKWFSESGKLVTKMFQKIQELIDDKDALVFVLIDEVESLTAARSAFKAGTEPSDAIRVVNAVLMQIDQIKRYPNVVILTTSNITEKIDMAFVDRADIKQYIGPPSAAAIFRIYLSCLEELMKCQIIYPRQHLLSLRELEMIGFVENNVSRLSLVLKEISRRSEGLSGRVLRKLPFLAHALYIQSPSVTMTAFLQALSLVVDKQFEERKKLADCV
Sequence Length
432
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for TRIP13 recombinant protein
This gene encodes a protein that interacts with thyroid hormone receptors, also known as hormone-dependent transcription factors. The gene product interacts specifically with the ligand binding domain. This gene is one of several that may play a role in early-stage non-small cell lung cancer.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,079 Da
NCBI Official Full Name
pachytene checkpoint protein 2 homolog
NCBI Official Synonym Full Names
thyroid hormone receptor interactor 13
NCBI Official Symbol
TRIP13
NCBI Protein Information
pachytene checkpoint protein 2 homolog
UniProt Protein Name
Pachytene checkpoint protein 2 homolog
UniProt Gene Name
TRIP13
UniProt Synonym Gene Names
PCH2; TR-interacting protein 13 homolog; TRIP-13 homolog
Uniprot Description
Plays a key role in chromosome recombination and chromosome structure development during meiosis. Required at early steps in meiotic recombination that leads to non-crossovers pathways. Also needed for efficient completion of homologous synapsis by influencing crossover distribution along the chromosomes affecting both crossovers and non-crossovers pathways ().
Similar Products
Product Notes
The TRIP13 trip13 (Catalog #AAA1025375) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-432, Full length protein. The amino acid sequence is listed below: MDEAAGDLKQ ALPNTCDNVQ IHVEVHQKSN STAKKEDIRM SVLKLLNRHN IVFGDYKWTE FDDGFLNSNV QSVSIVDTEL KLKERQPIDL SKSSLTIHIF HLNEEGPSIE NLEEENEDIV AANHWVLPAA EFHGLWESLI YDTEVKSHLL DYVTTTLLFS DRNVDSNLIS WNRVVLLHGP PGTGKTSLCK ALAQKLTIRL SYRYRYGQLI EINSHSLFSK WFSESGKLVT KMFQKIQELI DDKDALVFVL IDEVESLTAA RSAFKAGTEP SDAIRVVNAV LMQIDQIKRY PNVVILTTSN ITEKIDMAFV DRADIKQYIG PPSAAAIFRI YLSCLEELMK CQIIYPRQHL LSLRELEMIG FVENNVSRLS LVLKEISRRS EGLSGRVLRK LPFLAHALYI QSPSVTMTAF LQALSLVVDK QFEERKKLAD CV. It is sometimes possible for the material contained within the vial of "Pachytene checkpoint protein 2 homolog (TRIP13), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
