Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human PVRL3 Monoclonal Antibody | anti-PVRL3 antibody

PVRL3 (Poliovirus Receptor-related Protein 3, CDw113, Nectin-3, CD113, PRR3) (HRP)

Gene Names
NECTIN3; PPR3; PRR3; CD113; PVRL3; PVRR3; CDW113; NECTIN-3
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PVRL3; Monoclonal Antibody; PVRL3 (Poliovirus Receptor-related Protein 3; CDw113; Nectin-3; CD113; PRR3) (HRP); anti-PVRL3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D1
Specificity
Recognizes human PVRL3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
5197
Applicable Applications for anti-PVRL3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 6ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa59-167 from human PVRL3 (NP_056295) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PIIVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTV*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PVRL3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 6ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PVRL3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 6ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PVRL3 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PVRL3 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-PVRL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens nectin cell adhesion molecule 3 (NECTIN3), transcript variant 1, mRNA
NCBI Official Synonym Full Names
nectin cell adhesion molecule 3
NCBI Official Symbol
NECTIN3
NCBI Official Synonym Symbols
PPR3; PRR3; CD113; PVRL3; PVRR3; CDW113; NECTIN-3
NCBI Protein Information
nectin-3
UniProt Protein Name
Poliovirus receptor-related protein 3
UniProt Gene Name
PVRL3
UniProt Synonym Gene Names
PRR3
UniProt Entry Name
PVRL3_HUMAN

NCBI Description

This gene encodes a member of the nectin family of proteins, which function as adhesion molecules at adherens junctions. This family member interacts with other nectin-like proteins and with afadin, a filamentous actin-binding protein involved in the regulation of directional motility, cell proliferation and survival. This gene plays a role in ocular development involving the ciliary body. Mutations in this gene are believed to result in congenital ocular defects. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]

Uniprot Description

PVRL3: Plays a role in cell-cell adhesion through heterophilic trans-interactions with nectin-like proteins or nectins, such as trans-interaction with PVRL2/nectin-2 at Sertoli-spermatid junctions. Trans-interaction with PVR induces activation of CDC42 and RAC small G proteins through common signaling molecules such as SRC and RAP1. Also involved in the formation of cell-cell junctions, including adherens junctions and synapses. Induces endocytosis-mediated down-regulation of PVR from the cell surface, resulting in reduction of cell movement and proliferation. Plays a role in the morphology of the ciliary body. Belongs to the nectin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q13

Cellular Component: apical junction complex; postsynaptic membrane; cell-cell adherens junction; plasma membrane; integral to membrane

Molecular Function: protein binding; protein homodimerization activity; cell adhesion molecule binding

Biological Process: intercellular junction assembly and maintenance; cell-cell adhesion; fertilization; lens morphogenesis in camera-type eye; homophilic cell adhesion; retina morphogenesis in camera-type eye

Research Articles on PVRL3

Similar Products

Product Notes

The PVRL3 pvrl3 (Catalog #AAA6154446) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PVRL3 (Poliovirus Receptor-related Protein 3, CDw113, Nectin-3, CD113, PRR3) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PVRL3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 6ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PVRL3 pvrl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PVRL3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.