Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tripartite motif-containing 13 (Trim13) Recombinant Protein | Trim13 recombinant protein

Recombinant Rat Tripartite motif-containing 13 (Trim13)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tripartite motif-containing 13 (Trim13); Recombinant Rat Tripartite motif-containing 13 (Trim13); Trim13 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-407, full length protein
Sequence
MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGLLEGNVRNSLWRPSPFKCPTCRKETSATGVNSLQVNYSLKGIVEKYNKIKISPKMPVCKEHLGQPLNIFCVTDMQLICGVCATRGSHTKHVFSSIEDAYTQERDAFEFLFQSFETWRRGDALSRLDTLETNKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQTYDPEINKLNSILQEQRMAFNIAEAFKDVSEPIIFLQQMQEFREKIKVIKETPLPPSNLPTSPLMKNFDTSQWEDIKLVDVDKLSLPQDTGVLTSRSPWHPCLLLMAVVLLGLLVFFGPTVFLEWSPLEELATWKDCLSSFNSYLTKSADFVEQSVFYWEQMTDGLFVFSERVKNVSLVALNNVAEFVCKYKLL
Sequence Length
407
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,815 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM13
NCBI Official Synonym Full Names
tripartite motif-containing 13
NCBI Official Symbol
Trim13
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM13; tripartite motif-containing 13
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM13
UniProt Gene Name
Trim13
UniProt Synonym Gene Names
Rfp2

Uniprot Description

Endoplasmic reticulum (ER) membrane anchored E3 ligase involved in the retrotranslocation and turnover of membrane and secretory proteins from the ER through a set of processes named ER-associated degradation (ERAD). This process acts on misfolded proteins as well as in the regulated degradation of correctly folded proteins. Enhances ionizing radiation-induced p53/TP53 stability and apoptosis via ubiquitinating MDM2 and AKT1 and decreasing AKT1 kinase activity through MDM2 and AKT1 proteasomal degradation. Regulates ER stress-induced autophagy, and may act as a tumor suppressor. Plays also a role in innate immune response by stimulating NF-kappa-B activity in the TLR2 signaling pathway. Ubiquitinates TRAF6 via the 'Lys-29'-linked polyubiquitination chain resulting in NF-kappa-B activation. Participates as well in T-cell receptor-mediated NF-kappa-B activation. In the presence of TNF, modulates the IKK complex by regulating IKBKG/NEMO ubiquitination leading to the repression of NF-kappa-B.

Similar Products

Product Notes

The Trim13 trim13 (Catalog #AAA7057975) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-407, full length protein. The amino acid sequence is listed below: MELLEEDLTC PICCSLFDDP RVLPCSHNFC KKCLEGLLEG NVRNSLWRPS PFKCPTCRKE TSATGVNSLQ VNYSLKGIVE KYNKIKISPK MPVCKEHLGQ PLNIFCVTDM QLICGVCATR GSHTKHVFSS IEDAYTQERD AFEFLFQSFE TWRRGDALSR LDTLETNKRK SLQLLTKDSD KVKEFFEKLQ HTLDQKKNEI LSDFETMKLA VMQTYDPEIN KLNSILQEQR MAFNIAEAFK DVSEPIIFLQ QMQEFREKIK VIKETPLPPS NLPTSPLMKN FDTSQWEDIK LVDVDKLSLP QDTGVLTSRS PWHPCLLLMA VVLLGLLVFF GPTVFLEWSP LEELATWKDC LSSFNSYLTK SADFVEQSVF YWEQMTDGLF VFSERVKNVS LVALNNVAEF VCKYKLL. It is sometimes possible for the material contained within the vial of "Tripartite motif-containing 13 (Trim13), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.