Transformer-2 sex-determining protein (tra2) Recombinant Protein | tra2 recombinant protein

Recombinant Drosophila melanogaster Transformer-2 sex-determining protein (tra2)

Cat. Num. AAA1153290

• Gene Names: tra2; CG10128; DmelCG10128; TRA 2; tra-2; Tra-2; TRA-2; Tra2; TRA2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Transformer-2 sex-determining protein (tra2); Recombinant Drosophila melanogaster Transformer-2 sex-determining protein (tra2); tra2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-264, Full length protein
• Sequence: MDREPLSSGRLHCSARYKHKRSASSSSAGTTSSGHKDRRSDYDYCGSRRHQRSSSRRRSRSRSSSESPPPEPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDYRNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLRRTSSRY
• Sequence Length: 264

• Species: Drosophila melanogaster (Fruit fly)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 17136544
• NCBI GeneID: 36619
• NCBI Accession #: NP_476763.1
• NCBI GenBank Nucleotide #: NM_057415.3
• UniProt Accession #: P19018; Q0E977; Q9V734; A4UZH1
• Molecular Weight: 15,634 Da
• NCBI Official Full Name: transformer 2, isoform B
• NCBI Official Synonym Full Names: transformer 2
• NCBI Official Symbol: tra2
• NCBI Official Synonym Symbols: CG10128; DmelCG10128; TRA 2; tra-2; Tra-2; TRA-2; Tra2; TRA2
• NCBI Protein Information: CG10128 gene product from transcript CG10128-RA
• UniProt Protein Name: Transformer-2 sex-determining protein
• Protein Family: Transformer-2 protein
• UniProt Gene Name: tra2
• UniProt Synonym Gene Names: tra-2

Uniprot Description

Required for female sex determination in somatic cells and for spermatogenesis in male germ cells. Positive regulator of female-specific splicing and/or polyadenylation of doublesex (dsx) pre-mRNA. Splicing requires an enhancer complex, dsxRE (dsx repeat element: which contains six copies of a 13-nucleotide repeat and a purine-rich enhancer (PRE)). DsxRE is formed through cooperative interactions between tra, tra2 and the sr proteins, and these interactions require both the repeat sequences and PRE. PRE is required for specific binding of tra2 to the dsxRE. Protein-RNA and protein-protein interactions are involved in tra-2 dependent activation and repression of alternative splicing. Together with tra-2, plays a role in switching fru splicing from the male-specific pattern to the female-specific pattern through activation of the female-specific fru 5'-splice site.