Tumor necrosis factor Recombinant Protein | TNF recombinant protein

Recombinant Bovine Tumor necrosis factor protein

Cat. Num. AAA717150

• Gene Names: TNF; TNFa
• Applications: SDS-Page, ELISA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor necrosis factor; Recombinant Bovine Tumor necrosis factor protein; Tumor necrosis factor His tagged; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a; TNF recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence: LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL

• Applicable Applications for TNF recombinant protein: SDS-PAGE, ELISA
• Preparation and Storage: Store working aliquots at 4 degree C for up to one week. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended.

Related Product Information for TNF recombinant protein

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.

References

[1] "Cloning of two members of the TNF-superfamily in cattle: CD40 ligand and tumor necrosis factor alpha." Mertens B.E.L.C., Muriuki M., Gaidulis L. Immunogenetics 42:430-431(1995) [PubMed: 7590981] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 50-233 (ISOFORM 1). Tissue: Blood.
[2] "Rapid communication: single strand conformational polymorphism (SSCP) of bovine tumor necrosis factor alpha." Dietz A.B., Neibergs H.L., Womack J.E., Kehrli M.E. Jr. J. Anim. Sci. 75:2567-2567(1997) [PubMed: 9303477] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 91-193. Strain: Holstein.

NCBI and Uniprot Product Information

• NCBI GI #: 145279648
• NCBI GeneID: 280943
• NCBI Accession #: NP_776391.2
• NCBI GenBank Nucleotide #: NM_173966.2
• UniProt Accession #: Q06599; O18779; Q27978; A4IFT5; A9QWR7
• Molecular Weight: 23 KD
• NCBI Official Full Name: Bos taurus tumor necrosis factor (TNF), mRNA
• NCBI Official Symbol: TNF
• NCBI Official Synonym Symbols: TNFa
• NCBI Protein Information: tumor necrosis factor; TNF-a; TNF-alpha; cachectin; tumor necrosis factor alpha; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor ligand superfamily member 2; tumor necrosis factor, alpha (TNF superfamily, member 2)
• UniProt Protein Name: Tumor necrosis factor
• Protein Family: Tumor necrosis factor
• UniProt Gene Name: TNF
• UniProt Synonym Gene Names: TNFA; TNFSF2
• UniProt Entry Name: TNFA_BOVIN

Uniprot Description

Function: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.Subunit structure: Homotrimer By similarity.Subcellular location: Cell membrane; Single-pass type II membrane protein By similarity. Tumor necrosis factor, soluble form: Secreted By similarity. Post-translational modification: The soluble form derives from the membrane form by proteolytic processing By similarity.The membrane form, but not the soluble form, is phosphorylated on serine residues. Dephosphorylation of the membrane form occurs by binding to soluble TNFRSF1A/TNFR1 By similarity.Sequence similarities: Belongs to the tumor necrosis factor family.Sequence caution: The sequence AAA19573.1 differs from that shown. Reason: Erroneous gene model prediction.