Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-RPP38 Polyclonal Antibody)

Rabbit anti-Human RPP38 Polyclonal Antibody | anti-RPP38 antibody

RPP38 Polyclonal Antibody

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
RPP38; Polyclonal Antibody; RPP38 Polyclonal Antibody; ribonuclease P/MRP subunit p38; anti-RPP38 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.99 mg/ml (varies by lot)
Sequence Length
283
Applicable Applications for anti-RPP38 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human RPP38 (NP_892117.1).
Immunogen Sequence
VVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVR
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-RPP38 Polyclonal Antibody)

Western Blot (WB) (Western blot-RPP38 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
ribonuclease P protein subunit p38
NCBI Official Synonym Full Names
ribonuclease P/MRP subunit p38
NCBI Official Symbol
RPP38
NCBI Protein Information
ribonuclease P protein subunit p38
UniProt Protein Name
Ribonuclease P protein subunit p38
Protein Family
UniProt Gene Name
RPP38
UniProt Synonym Gene Names
RNaseP protein p38
UniProt Entry Name
RPP38_HUMAN

Research Articles on RPP38

Similar Products

Product Notes

The RPP38 rpp38 (Catalog #AAA9141039) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPP38 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPP38 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the RPP38 rpp38 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPP38, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.