SDS-PAGE
Tumor necrosis factor Recombinant Protein | TNF recombinant protein
Recombinant Sheep Tumor necrosis factor
Gene Names
TNF; TNF-alpha
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor necrosis factor; Recombinant Sheep Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a; TNF recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
78-234aa; Partial
Sequence
LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL
Sequence Length
234
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for TNF recombinant protein
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
References
Primary structure of ovine tumor necrosis factor alpha cDNA.Young A.J., Hay J.B., Chan J.Y.C.Nucleic Acids Res. 18:6723-6723(1990)
Sequence of the cDNA encoding ovine tumor necrosis factor-alpha
problems with cloning by inverse PCR.Green I.R., Sargan D.R.Gene 109:203-210(1991)
Molecular cloning, expression and characterization of ovine TNF alpha.Andrews A.E., Nash A.D., Barcham G.J., Brandon M.R.Immunol. Cell Biol. 69:273-283(1991)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.2 kDa
NCBI Official Full Name
tumor necrosis factor
NCBI Official Symbol
TNF
NCBI Official Synonym Symbols
TNF-alpha
NCBI Protein Information
tumor necrosis factor
UniProt Protein Name
Tumor necrosis factor
Protein Family
UniProt Gene Name
TNF
UniProt Synonym Gene Names
TNFA; TNFSF2; TNF-a; NTF; ICD1; ICD2
UniProt Entry Name
TNFA_SHEEP
Uniprot Description
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
Research Articles on TNF
Similar Products
Product Notes
The TNF tnf (Catalog #AAA956032) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 78-234aa; Partial. The amino acid sequence is listed below: LRSSSQASNN KPVAHVVANI SAPGQLRWGD SYANALMANG VELKDNQLVV PTDGLYLIYS QVLFRGHGCP STPLFLTHTI SRIAVSYQTK VNILSAIKSP CHRETLEGAE AKPWYEPIYQ GGVFQLEKGD RLSAEINLPE YLDYAESGQV YFGIIAL. It is sometimes possible for the material contained within the vial of "Tumor necrosis factor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
