Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tumor necrosis factor (TNF) Recombinant Protein | Tnf recombinant protein

Recombinant Guinea pig Tumor necrosis factor (TNF)

Gene Names
Tnf; TNFA; TNFSF2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor necrosis factor (TNF); Recombinant Guinea pig Tumor necrosis factor (TNF); Recombinant Tumor necrosis factor (TNF); Tumor necrosis factor; Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2; TNF-a Cleaved into the following 6 chains: 1. Tumor necrosis factor; membrane form; N-terminal fragment; NTF Intracellul; Tnf recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
57-234aa; Extracellular domain
Sequence
GPQREEQFSSGPPFRPLAQTLTLRSASQNDNDKPVAHVVANQQAEEELQWLSKRANALLA NGMGLSDNQLVVPSDGLYLIYSQVLFKGQGCPSYLLLTHTVSRLAVSYPEKVNLLSAIKS PCQKETPEGAERKPWYEPIYLGGVFQLQKGDRLSAEVNLPQYLDFADSGQIYFGVIAL
Sequence Length
234
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for Tnf recombinant protein
This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,794 Da
NCBI Official Full Name
tumor necrosis factor
NCBI Official Symbol
Tnf
NCBI Official Synonym Symbols
TNFA; TNFSF2
NCBI Protein Information
tumor necrosis factor; TNF-a; TNF-alpha; cachectin; tumor necrosis factor alpha; tumor necrosis factor ligand superfamily member 2
UniProt Protein Name
Tumor necrosis factor
Protein Family
UniProt Gene Name
TNF
UniProt Synonym Gene Names
TNFA; TNFSF2; TNF-a; NTF; ICD1; ICD2
UniProt Entry Name
TNFA_CAVPO

Uniprot Description

Function: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells

By similarity.

Subunit structure: Homotrimer. Interacts with SPPL2B

By similarity.

Subcellular location: Cell membrane; Single-pass type II membrane protein

By similarity. Tumor necrosis factor, membrane form: Membrane; Single-pass type II membrane protein

By similarity. Tumor necrosis factor, soluble form: Secreted

By similarity. C-domain 1: Secreted

By similarity. C-domain 2: Secreted

By similarity.

Post-translational modification: The soluble form derives from the membrane form by proteolytic processing. The membrane-bound form is further proteolytically processed by SPPL2A or SPPL2B through regulated intramembrane proteolysis producing TNF intracellular domains (ICD1 and ICD2) released in the cytosol and TNF C-domain 1 and C-domain 2 secreted into the extracellular space

By similarity.The membrane form, but not the soluble form, is phosphorylated on serine residues. Dephosphorylation of the membrane form occurs by binding to soluble TNFRSF1A/TNFR1

By similarity.O-glycosylated; glycans contain galactose, N-acetylgalactosamine and N-acetylneuraminic acid

By similarity.

Sequence similarities: Belongs to the tumor necrosis factor family.

Similar Products

Product Notes

The Tnf tnf (Catalog #AAA949836) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 57-234aa; Extracellular domain. The amino acid sequence is listed below: GPQREEQFSS GPPFRPLAQT LTLRSASQND NDKPVAHVVA NQQAEEELQW LSKRANALLA NGMGLSDNQL VVPSDGLYLI YSQVLFKGQG CPSYLLLTHT VSRLAVSYPE KVNLLSAIKS PCQKETPEGA ERKPWYEPIY LGGVFQLQKG DRLSAEVNLP QYLDFADSGQ IYFGVIAL. It is sometimes possible for the material contained within the vial of "Tumor necrosis factor (TNF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.