Tenascin (TNC) Recombinant Protein | TNC recombinant protein

Recombinant Human Tenascin (TNC), partial

Cat. Num. AAA1265425

• Gene Names: TNC; GP; JI; TN; HXB; GMEM; TN-C; DFNA56; 150-225
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tenascin (TNC); Recombinant Human Tenascin (TNC); partial; Cytotactin; GMEM; GP 150-225; Glioma-associated-extracellular matrix antigen; Hexabrachion; JI; Myotendinous antigen; Neuronectin; Tenascin-C; TN-C; TNC recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1888-2201. Partial-length
• Sequence: DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for TNC recombinant protein

Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6.

Product Categories/Family for TNC recombinant protein

Signal Transduction

References

The complete cDNA sequence of human hexabrachion (Tenascin) . A multidomain protein containing unique epidermal growth factor repeats.Nies D.E., Hemesath T.J., Kim J.H., Gulcher J.R., Stefansson K.J. Biol. Chem. 266:2818-2823(1991) Human tenascin primary structure, pre-mRNA splicing patterns and localization of the epitopes recognized by two monoclonal antibodies.Siri A., Carnemolla B., Saginati M., Leprini A., Casari G., Baralle F., Zardi L.Nucleic Acids Res. 19:525-531(1991) Structure of the human hexabrachion (tenascin) gene.Gulcher J.R., Nies D.E., Alexakos M.J., Ravikant N.A., Sturgill M.E., Marton L.S., Stefansson K.Proc. Natl. Acad. Sci. U.S.A. 88:9438-9442(1991) Human tenascin gene. Structure of the 5'-region, identification, and characterization of the transcription regulatory sequences.Gherzi R., Carnemolla B., Siri A., Ponassi M., Balza E., Zardi L.J. Biol. Chem. 270:3429-3434(1995) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004) Analysis of aggrecan and tenascin gene expression in mouse skeletal tissues by northern and in situ hybridization using species specific cDNA probes.Glumoff V., Savontaus M., Vehanen J., Vuorio E.Biochim. Biophys. Acta 1219:613-622(1994) An alternatively spliced region of the human hexabrachion contains a repeat of potential N-glycosylation sites.Gulcher J.R., Nies D.E., Marton L.S., Stefansson K.Proc. Natl. Acad. Sci. U.S.A. 86:1588-1592(1989) Binding of the NG2 proteoglycan to type VI collagen and other extracellular matrix molecules.Burg M.A., Tillet E., Timpl R., Stallcup W.B.J. Biol. Chem. 271:26110-26116(1996) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005) Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F.Proteomics 8:3833-3847(2008) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Structure of a fibronectin type III domain from tenascin phased by MAD analysis of the selenomethionyl protein.Leahy D.J., Hendrickson W.A., Aukhil I., Erickson H.P.Science 258:987-991(1992) Exome sequencing and linkage analysis identified tenascin-C (TNC) as a novel causative gene in nonsyndromic hearing loss.Zhao Y., Zhao F., Zong L., Zhang P., Guan L., Zhang J., Wang D., Wang J., Chai W., Lan L., Li Q., Han B., Yang L., Jin X., Yang W., Hu X., Wang X., Li N., Li Y., Petit C., Wang J., Wang H.Y., Wang Q.PLoS ONE 8:E69549-E69549(2013)

NCBI and Uniprot Product Information

• NCBI GI #: 153946395
• NCBI GeneID: 3371
• NCBI Accession #: NP_002151.2
• NCBI GenBank Nucleotide #: NM_002160.3
• UniProt Accession #: P24821; Q14583; Q15567; Q5T7S3; C9IYT7; C9J575; C9J6D9; C9J848
• Molecular Weight: 39.5 kDa
• NCBI Official Full Name: tenascin
• NCBI Official Synonym Full Names: tenascin C
• NCBI Official Symbol: TNC
• NCBI Official Synonym Symbols: GP; JI; TN; HXB; GMEM; TN-C; DFNA56; 150-225
• NCBI Protein Information: tenascin
• UniProt Protein Name: Tenascin
• Protein Family: Tenascin
• UniProt Gene Name: TNC
• UniProt Synonym Gene Names: HXB; TN; TN-C
• UniProt Entry Name: TENA_HUMAN

NCBI Description

This gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration. [provided by RefSeq, Jul 2011]

Uniprot Description

TNC: Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6. Belongs to the tenascin family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 9q33

Cellular Component: basement membrane; extracellular matrix; extracellular region; extracellular space; focal adhesion; membrane

Molecular Function: syndecan binding

Biological Process: axon regeneration in the peripheral nervous system; cell adhesion; extracellular matrix organization and biogenesis; negative regulation of cell adhesion; neuromuscular junction development; odontogenesis of dentine-containing teeth; osteoblast differentiation; positive regulation of cell proliferation; response to ethanol; response to mechanical stimulus; response to wounding; wound healing

Disease: Deafness, Autosomal Dominant 56