Transmembrane protein 17 (TMEM17) Recombinant Protein | TMEM17 recombinant protein
Recombinant Chicken Transmembrane protein 17 (TMEM17)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transmembrane protein 17 (TMEM17); Recombinant Chicken Transmembrane protein 17 (TMEM17); Recombinant Transmembrane protein 17 (TMEM17); Transmembrane protein 17; TMEM17 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-208
Sequence
MSLPEPLRRRLGSFSRTVFTDSRRAGPQYPSERADNEILSSLPLQMSLYFNVYFFPFWWLSTVFMLQLKYPVLSDYYKFILVTVMILTSLIEVIRLYLGYMGNLQEKVPELAGFWLLTLLLQLPVILFLLFNEGLNIQPLERSVNIIFALFLVFQVIAAFVTLKRMVNKLATHFHLNEFDRLEEHPVRHLYGPSKEENVLPMASMGPC
Sequence Length
208
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,272 Da
NCBI Official Full Name
transmembrane protein 17-like
NCBI Official Synonym Full Names
transmembrane protein 17
NCBI Official Symbol
TMEM17
NCBI Protein Information
transmembrane protein 17
UniProt Protein Name
Transmembrane protein 17
Protein Family
UniProt Gene Name
TMEM17
UniProt Entry Name
TMM17_CHICK
Uniprot Description
Function: Transmembrane component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling
By similarity.
Subunit structure: Part of the tectonic-like complex (also named B9 complex)
By similarity.
Subcellular location: Cell projection › cilium membrane; Multi-pass membrane protein
By similarity. Note: Localizes to the transition zone of primary cilia
By similarity.
Sequence similarities: Belongs to the TMEM17 family.
Similar Products
Product Notes
The TMEM17 tmem17 (Catalog #AAA1015368) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-208. The amino acid sequence is listed below: MSLPEPLRRR LGSFSRTVFT DSRRAGPQYP SERADNEILS SLPLQMSLYF NVYFFPFWWL STVFMLQLKY PVLSDYYKFI LVTVMILTSL IEVIRLYLGY MGNLQEKVPE LAGFWLLTLL LQLPVILFLL FNEGLNIQPL ERSVNIIFAL FLVFQVIAAF VTLKRMVNKL ATHFHLNEFD RLEEHPVRHL YGPSKEENVL PMASMGPC. It is sometimes possible for the material contained within the vial of "Transmembrane protein 17 (TMEM17), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
