Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tight junction protein ZO-1 (Tjp1) Recombinant Protein | Tjp1 recombinant protein

Recombinant Mouse Tight junction protein ZO-1 (Tjp1) , partial

Gene Names
Tjp1; ZO1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tight junction protein ZO-1 (Tjp1); Recombinant Mouse Tight junction protein ZO-1 (Tjp1); partial; Tjp1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1629-1745;Fragment at the C-terminal include the ZU5 domain
Sequence
VVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF
Sequence Length
1745
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Tjp1 recombinant protein
This gene encodes a protein located on a cytoplasmic membrane surface of intercellular tight junctions. The encoded protein may be involved in signal transduction at cell-cell junctions. Two transcript variants encoding distinct isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
194,742 Da
NCBI Official Full Name
tight junction protein ZO-1 isoform 1
NCBI Official Synonym Full Names
tight junction protein 1
NCBI Official Symbol
Tjp1
NCBI Official Synonym Symbols
ZO1
NCBI Protein Information
tight junction protein ZO-1
UniProt Protein Name
Tight junction protein ZO-1
Protein Family
UniProt Gene Name
Tjp1
UniProt Synonym Gene Names
Zo1

Uniprot Description

Tjp1, TjpP2, and Tjp3 are closely related scaffolding proteins that link tight junction (TJ) transmembrane proteins such as claudins, junctional adhesion molecules, and occludin to the actin cytoskeleton (). The tight junction acts to limit movement of substances through the paracellular space and as a boundary between the compositionally distinct apical and basolateral plasma membrane domains of epithelial and endothelial cells. Necessary for lumenogenesis, and particularly efficient epithelial polarization and barrier formation (). Plays a role in the regulation of cell migration by targeting Cdc42bpb to the leading edge of migrating cells (). Plays an important role in podosome formation and associated function, thus regulating cell adhesion and matrix remodeling (). With Tjp2 and TJjp3, participates to the junctional retention and stability of the transcription factor Dbpa, but is not involved in its shuttling to the nucleus ().

Research Articles on Tjp1

Similar Products

Product Notes

The Tjp1 tjp1 (Catalog #AAA717798) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1629-1745;Fragment at the C-terminal include the ZU5 domain. The amino acid sequence is listed below: VVATARGIFN SNGGVLSSIE TGVSIIIPQG AIPEGIEQEI YFKVCRDNSI LPPLDKEKGE TLLSPLVMCG PHGLKFLKPV ELRLPHCDPK TWQNKCLPGD PNYLVGANCV SVLIDHF . It is sometimes possible for the material contained within the vial of "Tight junction protein ZO-1 (Tjp1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.