Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Metalloproteinase inhibitor 4 Recombinant Protein | TIMP-4 recombinant protein

Recombinant Human Metalloproteinase inhibitor 4

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Metalloproteinase inhibitor 4; Recombinant Human Metalloproteinase inhibitor 4; Tissue inhibitor of metalloproteinases 4; TIMP-4; TIMP-4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
30-224aa; Full length
Sequence
CSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP
Sequence Length
224
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for TIMP-4 recombinant protein
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.
Product Categories/Family for TIMP-4 recombinant protein
References
Molecular cloning and characterization of human tissue inhibitor of metalloproteinase 4.Greene J., Wang M., Liu Y.E., Raymond L.A., Rosen C., Shi Y.E.J. Biol. Chem. 271:30375-30380(1996)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.4 kDa
NCBI Official Full Name
metalloproteinase inhibitor 4
NCBI Official Synonym Full Names
TIMP metallopeptidase inhibitor 4
NCBI Official Symbol
TIMP4
NCBI Protein Information
metalloproteinase inhibitor 4
UniProt Protein Name
Metalloproteinase inhibitor 4
UniProt Gene Name
TIMP4
UniProt Synonym Gene Names
TIMP-4
UniProt Entry Name
TIMP4_HUMAN

NCBI Description

This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. The secreted, netrin domain-containing protein encoded by this gene is involved in regulation of platelet aggregation and recruitment and may play role in hormonal regulation and endometrial tissue remodeling. [provided by RefSeq, Jul 2008]

Uniprot Description

TIMP4: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP- 9. Belongs to the protease inhibitor I35 (TIMP) family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 3p25

Cellular Component: extracellular space; proteinaceous extracellular matrix; sarcomere

Molecular Function: metal ion binding; metalloendopeptidase inhibitor activity; protease binding

Biological Process: central nervous system development; negative regulation of membrane protein ectodomain proteolysis; negative regulation of metalloenzyme activity; Notch signaling pathway; ovulation cycle; response to cytokine stimulus; response to drug; response to lipopolysaccharide; response to organic substance; response to peptide hormone stimulus

Research Articles on TIMP-4

Similar Products

Product Notes

The TIMP-4 timp4 (Catalog #AAA1309121) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-224aa; Full length. The amino acid sequence is listed below: CSCAPAHPQQ HICHSALVIR AKISSEKVVP ASADPADTEK MLRYEIKQIK MFKGFEKVKD VQYIYTPFDS SLCGVKLEAN SQKQYLLTGQ VLSDGKVFIH LCNYIEPWED LSLVQRESLN HHYHLNCGCQ ITTCYTVPCT ISAPNECLWT DWLLERKLYG YQAQHYVCMK HVDGTCSWYR GHLPLRKEFV DIVQP. It is sometimes possible for the material contained within the vial of "Metalloproteinase inhibitor 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.