Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mitochondrial import inner membrane translocase subunit TIM54 (TIM54) Recombinant Protein | TIM54 recombinant protein

Recombinant Candida albicans Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial import inner membrane translocase subunit TIM54 (TIM54); Recombinant Candida albicans Mitochondrial import inner membrane translocase subunit TIM54 (TIM54); Recombinant Mitochondrial import inner membrane translocase subunit TIM54 (TIM54); Mitochondrial import inner membrane translocase subunit TIM54; TIM54 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-400
Sequence
MPDANEVKPKKGWSNPALRMMGIPRISLPSRNWMIFWTVVTTIGGGIAYDKYEQKQMRKKWMDAVKQFGEVSYGANEIPRKLSIFIAPPPNDFLDESLKLFRKFIKPVLNAGVVDFEIFSESRQGDIRASVAEKIRELRRKQLVEETPKKNESNGNQDNDEEELKSRSDLYKAKDVLGLYKVFPADINVKSEDAIDDSSAGGIICVGRGAYKEYLSGVHEGLLGPLEKPQSVIDEETKLAEEKKKEKEENPDKDDDNDEEQSNLKPVPLRYIQPEDYANAQLAPELDLSTVVKDDKGVPVFFEQPVYTFPLPNLVGFTNIPRKIYRYFTKRFLVDDFGERTATIVNNKSRPFVYKDVLMAKEEEMDWPKKWVEKGKERNSEWVQELEHDERVTSRMKVFE
Sequence Length
400
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,113 Da
NCBI Official Full Name
hypothetical protein CaO19.12608
NCBI Official Symbol
TIM54
NCBI Protein Information
Mitochondrial inner membrane translocase; hypothetical protein
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit TIM54
UniProt Gene Name
TIM54
UniProt Entry Name
TIM54_CANAL

Uniprot Description

Function: Essential component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as external driving force

By similarity.

Subunit structure: Component of the TIM22 complex, whose core is composed of TIM22 and TIM54, associated with the 70 kDa heterohexamer composed of TIM9 and TIM10 (or TIM8 and TIM13)

By similarity.

Subcellular location: Mitochondrion inner membrane; Single-pass membrane protein

By similarity.

Sequence similarities: Belongs to the TIM54 family.

Similar Products

Product Notes

The TIM54 tim54 (Catalog #AAA1245073) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-400. The amino acid sequence is listed below: MPDANEVKPK KGWSNPALRM MGIPRISLPS RNWMIFWTVV TTIGGGIAYD KYEQKQMRKK WMDAVKQFGE VSYGANEIPR KLSIFIAPPP NDFLDESLKL FRKFIKPVLN AGVVDFEIFS ESRQGDIRAS VAEKIRELRR KQLVEETPKK NESNGNQDND EEELKSRSDL YKAKDVLGLY KVFPADINVK SEDAIDDSSA GGIICVGRGA YKEYLSGVHE GLLGPLEKPQ SVIDEETKLA EEKKKEKEEN PDKDDDNDEE QSNLKPVPLR YIQPEDYANA QLAPELDLST VVKDDKGVPV FFEQPVYTFP LPNLVGFTNI PRKIYRYFTK RFLVDDFGER TATIVNNKSR PFVYKDVLMA KEEEMDWPKK WVEKGKERNS EWVQELEHDE RVTSRMKVFE. It is sometimes possible for the material contained within the vial of "Mitochondrial import inner membrane translocase subunit TIM54 (TIM54), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.