Tubulin Folding Cofactor A Recombinant Protein | TBCA recombinant protein

Recombinant Tubulin Folding Cofactor A (TBCA)

Cat. Num. AAA2033571

• Applications: SDS-Page, Western Blot, ELISA, Immunoprecipitation
• Purity: > 95%
• Synonyms: Tubulin Folding Cofactor A; Recombinant Tubulin Folding Cofactor A (TBCA); TBC-A; CFA; Tubulin-Specific Chaperone A; TCP1-chaperonin cofactor A; TBCA recombinant protein

• Host: E Coli
• Purity/Purification: > 95%
• Form/Format: Supplied as lyophilized form in 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% sarcosyl, 5% trehalose, and preservative.
• Sequence: ADPRVRQIK IKTGVVKRLV KEKVMYEKEA KQQEEKIEKM RAEDGENYDIKKQAEILQESRMMIPDCQRR LEAAYLDLQR ILENEKDLEE AEEYKEARLV LDSVKLEA
• Sequence Length: 108

• Applicable Applications for TBCA recombinant protein: SDS-PAGE, Western (WB), ELISA (EIA), Immunoprecipitation (IP).
• Predicted Molecular Mass: 16.4kDa
• Usage: Reconstitute in sterile PBS, pH7.2-pH7.4.
• Endotoxin Level: <1.0EU per 1 ug (determined by the LAL method)
• Expression System: Prokaryotic expression
• Fragment: Ala2~Ala108
• Organism Species: Human
• Tag: two N-terminal Tags, His-tag and T7-tag
• Preparation and Storage: Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.; Stability Test: The thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. (Referring from China Biological Products Standard, which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

SDS-Page

NCBI and Uniprot Product Information

• NCBI GI #: 75991681
• NCBI GeneID: 6902
• Molecular Weight: 15,792 Da
• NCBI Official Full Name: Tubulin folding cofactor A
• NCBI Official Synonym Full Names: tubulin folding cofactor A
• NCBI Official Symbol: TBCA
• NCBI Protein Information: tubulin-specific chaperone A
• UniProt Protein Name: Tubulin-specific chaperone A
• UniProt Gene Name: TBCA
• UniProt Synonym Gene Names: CFA
• UniProt Entry Name: TBCA_HUMAN

NCBI Description

The product of this gene is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. This gene encodes chaperonin cofactor A. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]

Uniprot Description

TBCA: Tubulin-folding protein; involved in the early step of the tubulin folding pathway. Belongs to the TBCA family.

Protein type: Chaperone

Chromosomal Location of Human Ortholog: 5q14.1

Cellular Component: cytoplasm; microtubule; microtubule cytoskeleton; nucleolus

Molecular Function: chaperone binding; protein binding; tubulin binding; unfolded protein binding

Biological Process: 'de novo' posttranslational protein folding; cellular protein metabolic process; post-chaperonin tubulin folding pathway; protein folding; tubulin folding