Tax1-binding protein 3 Recombinant Protein | TAX1BP3 recombinant protein

Recombinant Human Tax1-binding protein 3

Cat. Num. AAA717133

• Gene Names: TAX1BP3; TIP-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tax1-binding protein 3; Recombinant Human Tax1-binding protein 3; Glutaminase-interacting protein 3; Tax interaction protein 1; TIP-1; Tax-interacting protein 1; TAX1BP3 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-124aa; Full Length
• Sequence: MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
• Sequence Length: 98

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for TAX1BP3 recombinant protein

May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.

Product Categories/Family for TAX1BP3 recombinant protein

Signal Transduction

References

The C-terminus of the HTLV-1 Tax oncoprotein mediates interaction with the PDZ domain of cellular proteins.Rousset R., Fabre S., Desbois C., Bantignies F., Jalinot P.Oncogene 16:643-654(1998) The genomic region encompassing the nephropathic cystinosis gene (CTNS) complete sequencing of a 200-kb segment and discovery of a novel gene within the common cystinosis-causing deletion.Touchman J.W., Anikster Y., Dietrich N.L., Maduro V.V.B., McDowell G., Shotelersuk V., Bouffard G.G., Beckstrom-Sternberg S.M., Gahl W.A., Green E.D.Genome Res. 10:165-173(2000) The C-terminus of human glutaminase L mediates association with PDZ domain-containing proteins.Olalla L., Aledo J.C., Bannenberg G., Marquez J.FEBS Lett. 488:116-122(2001) hPWP1-interacting proteins 2 and 11 (Tax-interacting protein 1) .Honore B. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 325296954
• NCBI GeneID: 30851
• NCBI Accession #: NP_001191627.1
• NCBI GenBank Nucleotide #: NM_001204698.1
• UniProt Accession #: O14907; Q7LCQ4; B2RD53; D3DTJ6
• Molecular Weight: 40.7 kDa
• NCBI Official Full Name: tax1-binding protein 3 isoform 2
• NCBI Official Synonym Full Names: Tax1 (human T-cell leukemia virus type I) binding protein 3
• NCBI Official Symbol: TAX1BP3
• NCBI Official Synonym Symbols: TIP-1
• NCBI Protein Information: tax1-binding protein 3
• UniProt Protein Name: Tax1-binding protein 3
• Protein Family: Tax1-binding protein
• UniProt Gene Name: TAX1BP3
• UniProt Synonym Gene Names: TIP-1
• UniProt Entry Name: TX1B3_HUMAN

NCBI Description

This gene encodes a small, highly conserved protein with a single PDZ domain. PDZ (PSD-95/Discs large/ZO-1 homologous) domains promote protein-protein interactions that affect cell signaling, adhesion, protein scaffolding, and receptor and ion transporter functions. The encoded protein interacts with a large number of target proteins that play roles in signaling pathways; for example, it interacts with Rho A and glutaminase L and also acts as a negative regulator of the Wnt/beta-catenin signaling pathway. This protein was first identified as binding to the T-cell leukaemia virus (HTLV1) Tax oncoprotein. Overexpression of this gene has been implicated in altered cancer cell adhesion, migration and metastasis. The encoded protein also modulates the localization and density of inwardly rectifying potassium channel 2.3 (Kir2.3). To date, this protein has been shown to play a role in cell proliferation, development, stress response, and polarization. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Apr 2017]

Uniprot Description

TAX1BP3: May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.

Protein type: Cell cycle regulation; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: cytoplasm; cytosol; nucleus; plasma membrane

Molecular Function: beta-catenin binding; protein binding; protein C-terminus binding

Biological Process: negative regulation of cell proliferation; negative regulation of Wnt receptor signaling pathway; Rho protein signal transduction; small GTPase mediated signal transduction; Wnt receptor signaling pathway