Mouse anti-Human TAX1BP3 Monoclonal Antibody | anti-TAX1BP3 antibody

TAX1BP3 (Tax1-binding Protein 3, Glutaminase-interacting Protein 3, Tax Interaction Protein 1, Tax-interacting Protein 1, TIP1, TIP-1)

Cat. Num. AAA6003913

• Gene Names: TAX1BP3; TIP-1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: TAX1BP3; Monoclonal Antibody; TAX1BP3 (Tax1-binding Protein 3; Glutaminase-interacting Protein 3; Tax Interaction Protein 1; Tax-interacting Protein 1; TIP1; TIP-1); Anti -TAX1BP3 (Tax1-binding Protein 3; anti-TAX1BP3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4A10
• Specificity: Recognizes human TAX1BP3.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS

• Applicable Applications for anti-TAX1BP3 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant corresponding to aa1-125 from human TAX1BP3 (AAH23980) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (39.75kD).)

Testing Data

(Detection limit for recombinant GST tagged TAX1BP3 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-TAX1BP3 antibody

Antibodies; Abs to Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 325296954
• NCBI GeneID: 30851
• NCBI Accession #: NP_001191627.1
• NCBI GenBank Nucleotide #: NM_001204698.1
• UniProt Accession #: O14907; Q7LCQ4; B2RD53; D3DTJ6
• Molecular Weight: 13,735 Da
• NCBI Official Full Name: tax1-binding protein 3 isoform 2
• NCBI Official Synonym Full Names: Tax1 (human T-cell leukemia virus type I) binding protein 3
• NCBI Official Symbol: TAX1BP3
• NCBI Official Synonym Symbols: TIP-1
• NCBI Protein Information: tax1-binding protein 3; Tax interaction protein 1; tax-interacting protein 1; glutaminase-interacting protein 3
• UniProt Protein Name: Tax1-binding protein 3
• Protein Family: Tax1-binding protein
• UniProt Gene Name: TAX1BP3
• UniProt Synonym Gene Names: TIP1; TIP-1
• UniProt Entry Name: TX1B3_HUMAN

Uniprot Description

TAX1BP3: May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.

Protein type: Cell cycle regulation; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: cytoplasm; plasma membrane; nucleus; actin cytoskeleton

Molecular Function: protein C-terminus binding; protein binding; beta-catenin binding

Biological Process: negative regulation of cell proliferation; negative regulation of Wnt receptor signaling pathway; Wnt receptor signaling pathway; Rho protein signal transduction