Transcription initiation factor TFIID subunit 9B (TAF9B) Recombinant Protein | TAF9B recombinant protein

Recombinant Human Transcription initiation factor TFIID subunit 9B (TAF9B)

Cat. Num. AAA1480249

• Gene Names: TAF9B; DN7; DN-7; TAF9L; TAFII31L; TFIID-31
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Transcription initiation factor TFIID subunit 9B (TAF9B); Recombinant Human Transcription initiation factor TFIID subunit 9B (TAF9B); TAF9B recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-251, Full length protein
• Sequence: MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM
• Sequence Length: 251

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for TAF9B recombinant protein

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that is similar to one of the small subunits of TFIID, TBP-associated factor 9, and is also a subunit of TFIID. TAF9 and TAF9b share some functions but also have distinct roles in the transcriptional regulatory process.

NCBI and Uniprot Product Information

• NCBI GI #: 20070280
• NCBI GeneID: 51616
• NCBI Accession #: NP_057059.2
• NCBI GenBank Nucleotide #: NM_015975.4
• UniProt Accession #: Q9HBM6; Q9Y2S3; B2RUZ9
• Molecular Weight: 27,622 Da
• NCBI Official Full Name: transcription initiation factor TFIID subunit 9B
• NCBI Official Synonym Full Names: TATA-box binding protein associated factor 9b
• NCBI Official Symbol: TAF9B
• NCBI Official Synonym Symbols: DN7; DN-7; TAF9L; TAFII31L; TFIID-31
• NCBI Protein Information: transcription initiation factor TFIID subunit 9B
• UniProt Protein Name: Transcription initiation factor TFIID subunit 9B
• Protein Family: Transcription initiation factor
• UniProt Gene Name: TAF9B
• UniProt Synonym Gene Names: TAF9L; DN-7

NCBI Description

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that is similar to one of the small subunits of TFIID, TBP-associated factor 9, and is also a subunit of TFIID. TAF9 and TAF9b share some functions but also have distinct roles in the transcriptional regulatory process. [provided by RefSeq, Jul 2008]

Uniprot Description

Essential for cell viability. TAF9 and TAF9B are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes. May have a role in gene regulation associated with apoptosis. TAFs are components of the transcription factor IID (TFIID) complex, the TBP-free TAFII complex (TFTC), the PCAF histone acetylase complex and the STAGA transcription coactivator-HAT complex. TFIID or TFTC are essential for the regulation of RNA polymerase II-mediated transcription.