Rabbit anti-Human TAF9B Polyclonal Antibody | anti-TAF9B antibody

TAF9B Polyclonal Antibody

Cat. Num. AAA9140554

• Gene Names: TAF9B; DN7; DN-7; TAF9L; TAFII31L; TFIID-31
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: TAF9B; Polyclonal Antibody; TAF9B Polyclonal Antibody; DN-7; DN7; TAF9L; TAFII31L; TFIID-31; TATA-box binding protein associated factor 9b; anti-TAF9B antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 4.21 mg/ml (varies by lot)
• Sequence Length: 251

• Applicable Applications for anti-TAF9B antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TAF9B (NP_057059.2).
• Immunogen Sequence: ILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGA
• Positive Samples: HeLa
• Cellular Location: Nucleus
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-TAF9B Polyclonal Antibody)

Related Product Information for anti-TAF9B antibody

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that is similar to one of the small subunits of TFIID, TBP-associated factor 9, and is also a subunit of TFIID. TAF9 and TAF9b share some functions but also have distinct roles in the transcriptional regulatory process.

NCBI and Uniprot Product Information

• NCBI GI #: 74752778
• NCBI GeneID: 51616
• UniProt Accession #: Q9HBM6
• Molecular Weight: Calculated: 27kDa; Observed: 28kDa
• NCBI Official Full Name: Transcription initiation factor TFIID subunit 9B
• NCBI Official Synonym Full Names: TATA-box binding protein associated factor 9b
• NCBI Official Symbol: TAF9B
• NCBI Official Synonym Symbols: DN7; DN-7; TAF9L; TAFII31L; TFIID-31
• NCBI Protein Information: transcription initiation factor TFIID subunit 9B
• UniProt Protein Name: Transcription initiation factor TFIID subunit 9B
• Protein Family: Transcription initiation factor
• UniProt Gene Name: TAF9B
• UniProt Synonym Gene Names: TAF9L
• UniProt Entry Name: TAF9B_HUMAN

NCBI Description

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that is similar to one of the small subunits of TFIID, TBP-associated factor 9, and is also a subunit of TFIID. TAF9 and TAF9b share some functions but also have distinct roles in the transcriptional regulatory process. [provided by RefSeq, Jul 2008]

Uniprot Description

TAF9B: Essential for cell viability. TAF9 and TAF9B are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes. May have a role in gene regulation associated with apoptosis. TAFs are components of the transcription factor IID (TFIID) complex, the TBP-free TAFII complex (TFTC), the PCAF histone acetylase complex and the STAGA transcription coactivator-HAT complex. TFIID or TFTC are essential for the regulation of RNA polymerase II-mediated transcription. Belongs to the TAF9 family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: Xq13.1-q21.1

Cellular Component: nucleoplasm; transcription factor TFIID complex

Molecular Function: protein binding; protein heterodimerization activity; transcription corepressor activity

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; viral reproduction; protein stabilization; RNA elongation from RNA polymerase II promoter; gene expression; negative regulation of transcription from RNA polymerase II promoter; positive regulation of cell growth; negative regulation of apoptosis