Transcription initiation factor TFIID subunit 7-like (TAF7L) Recombinant Protein | TAF7L recombinant protein

Recombinant Human Transcription initiation factor TFIID subunit 7-like (TAF7L)

Cat. Num. AAA9018596

• Gene Names: TAF7L; CT40; TAF2Q
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Transcription initiation factor TFIID subunit 7-like (TAF7L); Recombinant Human Transcription initiation factor TFIID subunit 7-like (TAF7L); Cancer/testis antigen 40 (CT40)(RNA polymerase II TBP-associated factor subunit Q)(TATA box-binding protein-associated factor 50kDa)(Transcription initiation factor TFIID 50kDa subunit); TAF7L recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-302aa, Full Length of Isoform 3
• Sequence: MSESQDEVPDEVENQFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRKKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSVMEIQKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQKNEKLISLQEQLQRFLKK

• Species: Homo sapiens (Human)
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for TAF7L recombinant protein

Epigenetics and Nuclear Signaling

NCBI and Uniprot Product Information

• NCBI GI #: 270483792
• NCBI GeneID: 54457
• NCBI Accession #: NP_079161.3
• NCBI GenBank Nucleotide #: NM_024885.3
• UniProt Accession #: Q5H9L4; Q5H9L6; Q86XI4; Q9BXU5; Q9H5R0
• Molecular Weight: 34,726 Da
• NCBI Official Full Name: transcription initiation factor TFIID subunit 7-like isoform 1
• NCBI Official Synonym Full Names: TATA-box binding protein associated factor 7 like
• NCBI Official Symbol: TAF7L
• NCBI Official Synonym Symbols: CT40; TAF2Q
• NCBI Protein Information: transcription initiation factor TFIID subunit 7-like
• UniProt Protein Name: Transcription initiation factor TFIID subunit 7-like
• Protein Family: Transcription initiation factor
• UniProt Gene Name: TAF7L
• UniProt Synonym Gene Names: TAF2Q; CT40

NCBI Description

This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. The encoded protein could be a spermatogenesis-specific component of the DNA-binding general transcription factor complex TFIID. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]

Uniprot Description

TAF7L: Probably functions as a spermatogensis-specific component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. May play a role in spermatogenesis. Belongs to the TAF7 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cancer Testis Antigen (CTA); DNA-binding

Chromosomal Location of Human Ortholog: Xq22.1

Cellular Component: transcription factor TFIID complex

Molecular Function: histone acetyltransferase binding; transcription coactivator activity; transcription factor binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcriptional preinitiation complex assembly