Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transcription initiation factor TFIID subunit 7-like (Taf7l) Recombinant Protein | Taf7l recombinant protein

Recombinant Mouse Transcription initiation factor TFIID subunit 7-like (Taf7l)

Gene Names
Taf7l; Taf2q; 4933438I11Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription initiation factor TFIID subunit 7-like (Taf7l); Recombinant Mouse Transcription initiation factor TFIID subunit 7-like (Taf7l); Taf7l recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-471, full length protein
Sequence
MERGEEAPTEGAPPEGALVEAKAPVIPEAPATDVSTTEEAGSKEPQVPSGPRPEGAGDTCDTRGARGPPTPGRAKSQKTPRQGTARCQTLESAMRSMSVRLECHDVEEQFILRLPPEQAYAVRKIIHSRNAAWKDKLKIDFSPDGHHAVVQVDNVSLPAKLVNLPCVIGSLKTIDRKTFYKTADVSQMLVCSPEGEPHSPPEEPVVSTGPTVIGISEGKAERKKYNWKHGITPPLKNVRKKRFRKTTKKLPDVKQVDEINFSEYTQSPSVEKEVKRLLYSDAEAVSVRWEVVDDDDAKEIESQGSMPTTPGISQMGGASLSDYDVFREMMGDSGSNSNDVEEKSNEGDDDDDEDEDDEDYGNEKEEEETDNSEEELEKELQAKFNEFSLHEADQDYSSITMAIQKLIFIKEKRLQMIYKKAQRQKELLRKVENLTLKRHFQNVLGKLNIMEKEKCEQIYHLQEQLKCFLKE
Sequence Length
471
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Taf7l recombinant protein
This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. The encoded protein could be a spermatogenesis-specific component of the DNA-binding general transcription factor complex TFIID. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,461 Da
NCBI Official Full Name
transcription initiation factor TFIID subunit 7-like
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 7 like
NCBI Official Symbol
Taf7l
NCBI Official Synonym Symbols
Taf2q; 4933438I11Rik
NCBI Protein Information
transcription initiation factor TFIID subunit 7-like
UniProt Protein Name
Transcription initiation factor TFIID subunit 7-like
UniProt Gene Name
Taf7l
UniProt Synonym Gene Names
Taf2q

Uniprot Description

Probably functions as a spermatogensis-specific component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. May play a role in spermatogenesis.

Research Articles on Taf7l

Similar Products

Product Notes

The Taf7l taf7l (Catalog #AAA1401003) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-471, full length protein. The amino acid sequence is listed below: MERGEEAPTE GAPPEGALVE AKAPVIPEAP ATDVSTTEEA GSKEPQVPSG PRPEGAGDTC DTRGARGPPT PGRAKSQKTP RQGTARCQTL ESAMRSMSVR LECHDVEEQF ILRLPPEQAY AVRKIIHSRN AAWKDKLKID FSPDGHHAVV QVDNVSLPAK LVNLPCVIGS LKTIDRKTFY KTADVSQMLV CSPEGEPHSP PEEPVVSTGP TVIGISEGKA ERKKYNWKHG ITPPLKNVRK KRFRKTTKKL PDVKQVDEIN FSEYTQSPSV EKEVKRLLYS DAEAVSVRWE VVDDDDAKEI ESQGSMPTTP GISQMGGASL SDYDVFREMM GDSGSNSNDV EEKSNEGDDD DDEDEDDEDY GNEKEEEETD NSEEELEKEL QAKFNEFSLH EADQDYSSIT MAIQKLIFIK EKRLQMIYKK AQRQKELLRK VENLTLKRHF QNVLGKLNIM EKEKCEQIYH LQEQLKCFLK E. It is sometimes possible for the material contained within the vial of "Transcription initiation factor TFIID subunit 7-like (Taf7l), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.