Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.33kD).)

Mouse anti-Human TAF7L Monoclonal Antibody | anti-TAF7L antibody

TAF7L (Transcription Initiation Factor TFIID Subunit 7-like, Cancer/Testis Antigen 40, CT40, RNA Polymerase II TBP-associated Factor Subunit Q, TATA Box-binding Protein-associated Factor 50kD, Transcription Initiation Factor TFIID 50kD Subunit, TAF2Q, FLJ

Gene Names
TAF7L; CT40; TAF2Q
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TAF7L; Monoclonal Antibody; TAF7L (Transcription Initiation Factor TFIID Subunit 7-like; Cancer/Testis Antigen 40; CT40; RNA Polymerase II TBP-associated Factor Subunit Q; TATA Box-binding Protein-associated Factor 50kD; Transcription Initiation Factor TFIID 50kD Subunit; TAF2Q; FLJ; anti-TAF7L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3E10
Specificity
Recognizes human TAF7L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-TAF7L antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa231-333 from human TAF7L (NP_079161) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSEYDMLREMFSDSRSNN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.33kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.33kD).)

Testing Data

(Detection limit for recombinant GST tagged TAF7L is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TAF7L is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-TAF7L antibody
This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. The encoded protein could be a spermatogenesis-specific component of the DNA-binding general transcription factor complex TFIID. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-TAF7L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
transcription initiation factor TFIID subunit 7-like isoform 1
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 7 like
NCBI Official Symbol
TAF7L
NCBI Official Synonym Symbols
CT40; TAF2Q
NCBI Protein Information
transcription initiation factor TFIID subunit 7-like
UniProt Protein Name
Transcription initiation factor TFIID subunit 7-like
UniProt Gene Name
TAF7L
UniProt Synonym Gene Names
TAF2Q; CT40

NCBI Description

This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. The encoded protein could be a spermatogenesis-specific component of the DNA-binding general transcription factor complex TFIID. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]

Uniprot Description

TAF7L: Probably functions as a spermatogensis-specific component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. May play a role in spermatogenesis. Belongs to the TAF7 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cancer Testis Antigen (CTA); DNA-binding

Chromosomal Location of Human Ortholog: Xq22.1

Cellular Component: transcription factor TFIID complex

Molecular Function: histone acetyltransferase binding; transcription coactivator activity; transcription factor binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcriptional preinitiation complex assembly

Research Articles on TAF7L

Similar Products

Product Notes

The TAF7L taf7l (Catalog #AAA6150020) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TAF7L (Transcription Initiation Factor TFIID Subunit 7-like, Cancer/Testis Antigen 40, CT40, RNA Polymerase II TBP-associated Factor Subunit Q, TATA Box-binding Protein-associated Factor 50kD, Transcription Initiation Factor TFIID 50kD Subunit, TAF2Q, FLJ reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAF7L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAF7L taf7l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAF7L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.