Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Transcriptional adapter 3 Recombinant Protein | TADA3 recombinant protein

Recombinant Human Transcriptional adapter 3 protein

Gene Names
TADA3; ADA3; NGG1; hADA3; STAF54; TADA3L
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcriptional adapter 3; Recombinant Human Transcriptional adapter 3 protein; ADA3 homolog; hADA3; STAF54; Transcriptional adapter 3-like; ADA3-like protein; TADA3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-238aa; Partial
Sequence
MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVD
Sequence Length
432
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for TADA3 recombinant protein
Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. Also known as a coactivator for p53/TP53-dependent transcriptional activation. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
Product Categories/Family for TADA3 recombinant protein
References
Histone-like TAFs within the PCAF histone acetylase complex.Ogryzko V.V., Kotani T., Zhang X., Schiltz R.L., Howard T., Yang X.-J., Howard B.H., Qin J., Nakatani Y.Cell 94:35-44(1998)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53.9 kDa
NCBI Official Full Name
transcriptional adapter 3 isoform a
NCBI Official Synonym Full Names
transcriptional adaptor 3
NCBI Official Symbol
TADA3
NCBI Official Synonym Symbols
ADA3; NGG1; hADA3; STAF54; TADA3L
NCBI Protein Information
transcriptional adapter 3
UniProt Protein Name
Transcriptional adapter 3
Protein Family
UniProt Gene Name
TADA3
UniProt Synonym Gene Names
ADA3; TADA3L; hADA3; ADA3-like protein
UniProt Entry Name
TADA3_HUMAN

NCBI Description

DNA-binding transcriptional activator proteins increase the rate of transcription by interacting with the transcriptional machinery bound to the basal promoter in conjunction with adaptor proteins, possibly by acetylation and destabilization of nucleosomes. The protein encoded by this gene is a transcriptional activator adaptor and a component of the histone acetyl transferase (HAT) coactivator complex which plays a crucial role in chromatin modulation and cell cycle progression. Along with the other components of the complex, this protein links transcriptional activators bound to specific promoters, to histone acetylation and the transcriptional machinery. The protein is also involved in the stabilization and activation of the p53 tumor suppressor protein that plays a role in the cellular response to DNA damage. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]

Uniprot Description

TADA3L: Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. Also known as a coactivator for p53/TP53-dependent transcriptional activation. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. Belongs to the NGG1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; Transcription factor

Chromosomal Location of Human Ortholog: 3p25.3

Cellular Component: intracellular; nucleoplasm; nucleus

Molecular Function: histone acetyltransferase activity; ligand-dependent nuclear receptor binding; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; protein domain specific binding; transcription coactivator activity; transcription factor activity

Biological Process: establishment and/or maintenance of chromatin architecture; estrogen receptor signaling pathway; mitosis; positive regulation of transcription, DNA-dependent; regulation of histone deacetylation; regulation of protein amino acid phosphorylation; regulation of protein stability; regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent

Research Articles on TADA3

Similar Products

Product Notes

The TADA3 tada3 (Catalog #AAA717209) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-238aa; Partial. The amino acid sequence is listed below: MSELKDCPLQ FHDFKSVDHL KVCPRYTAVL ARSEDDGIGI EELDTLQLEL ETLLSSASRR LRVLEAETQI LTDWQDKKGD RRFLKLGRDH ELGAPPKHGK PKKQKLEGKA GHGPGPGPGR PKSKNLQPKI QEYEFTDDPI DVPRIPKNDA PNRFWASVEP YCADITSEEV RTLEELLKPP EDEAEHYKIP PLGKHYSQRW AQEDLLEEQK DGARAAAVAD KKKGLMGPLT ELDTKDVD. It is sometimes possible for the material contained within the vial of "Transcriptional adapter 3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.