Trace amine-associated receptor 5 (TAAR5) Recombinant Protein | TAAR5 recombinant protein
Recombinant Human Trace amine-associated receptor 5 (TAAR5)
Gene Names
TAAR5; PNR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Trace amine-associated receptor 5 (TAAR5); Recombinant Human Trace amine-associated receptor 5 (TAAR5); TAAR5 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-337aa; Full length protein
Sequence
MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVS YFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLT SIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLS QWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSL AGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSAC NPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for TAAR5 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,242 Da
NCBI Official Full Name
trace amine-associated receptor 5
NCBI Official Synonym Full Names
trace amine associated receptor 5
NCBI Official Symbol
TAAR5
NCBI Official Synonym Symbols
PNR
NCBI Protein Information
trace amine-associated receptor 5
UniProt Protein Name
Trace amine-associated receptor 5
Protein Family
UniProt Gene Name
TAAR5
UniProt Synonym Gene Names
PNR; TaR-5; Trace amine receptor 5; hTaar5
UniProt Entry Name
TAAR5_HUMAN
Uniprot Description
TAAR5: Orphan receptor. Ligands are likely small molecules, either sharing some similarities with trace amine as, e.g. derivatives of indolamines (such as 5-methoxytryptamine) or of phenylethylamines (such as phenylethanolamine) or being any kind of metabolite of amino acids or biogenic amine neurotransmitters. Belongs to the G-protein coupled receptor 1 family.
Protein type: Membrane protein, integral; Receptor, GPCR; GPCR, family 1; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 6q23
Cellular Component: integral to membrane; integral to plasma membrane
Molecular Function: G-protein coupled receptor activity
Biological Process: G-protein coupled receptor protein signaling pathway; sensory perception of chemical stimulus; signal transduction
Research Articles on TAAR5
Similar Products
Product Notes
The TAAR5 taar5 (Catalog #AAA7030798) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-337aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the TAAR5 taar5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRAVFIQGAE EHPAAFCYQV NGSCPRTVHT LGIQLVIYLA CAAGMLIIVL GNVFVAFAVS YFKALHTPTN FLLLSLALAD MFLGLLVLPL STIRSVESCW FFGDFLCRLH TYLDTLFCLT SIFHLCFISI DRHCAICDPL LYPSKFTVRV ALRYILAGWG VPAAYTSLFL YTDVVETRLS QWLEEMPCVG SCQLLLNKFW GWLNFPLFFV PCLIMISLYV KIFVVATRQA QQITTLSKSL AGAAKHERKA AKTLGIAVGI YLLCWLPFTI DTMVDSLLHF ITPPLVFDIF IWFAYFNSAC NPIIYVFSYQ WFRKALKLTL SQKVFSPQTR TVDLYQE. It is sometimes possible for the material contained within the vial of "Trace amine-associated receptor 5 (TAAR5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
