Synaptotagmin-1 Recombinant Protein | SYT1 recombinant protein

Recombinant Human Synaptotagmin-1

Cat. Num. AAA962491

• Gene Names: SYT1; P65; SYT; SVP65
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Synaptotagmin-1; Recombinant Human Synaptotagmin-1; Synaptotagmin I; SytIp65; SYT1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 99-416aa; Partial
• Sequence: KNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDA

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SYT1 recombinant protein

May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca2+-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca2+-independent manner; these are neurexins, syntaxin and AP2.

Product Categories/Family for SYT1 recombinant protein

Neuroscience

References

Structural and functional conservation of synaptotagmin (p65) in Drosophila and humans.Perin M.S., Johnston P.A., Oezcelik T., Jahn R., Francke U., Suedhof T.C.J. Biol. Chem. 266:615-622(1991) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. Human SCAMP5, a novel secretory carrier membrane protein, facilitates calcium-triggered cytokine secretion by interaction with SNARE machinery.Han C., Chen T., Yang M., Li N., Liu H., Cao X.J. Immunol. 182:2986-2996(2009) System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3(2011) Identification of a human synaptotagmin-1 mutation that perturbs synaptic vesicle cycling.Baker K., Gordon S.L., Grozeva D., van Kogelenberg M., Roberts N.Y., Pike M., Blair E., Hurles M.E., Chong W.K., Baldeweg T., Kurian M.A., Boyd S.G., Cousin M.A., Raymond F.L.J. Clin. Invest. 0:0-0(2015)

NCBI and Uniprot Product Information

• NCBI GI #: 209447070
• NCBI GeneID: 6857
• NCBI Accession #: NP_001129277.1
• NCBI GenBank Nucleotide #: NM_001135805.1
• UniProt Accession #: P21579; Q6AI31
• Molecular Weight: 40.3 kDa
• NCBI Official Full Name: synaptotagmin-1 isoform 1
• NCBI Official Synonym Full Names: synaptotagmin 1
• NCBI Official Symbol: SYT1
• NCBI Official Synonym Symbols: P65; SYT; SVP65
• NCBI Protein Information: synaptotagmin-1
• UniProt Protein Name: Synaptotagmin-1
• Protein Family: Synaptotagmin
• UniProt Gene Name: SYT1
• UniProt Synonym Gene Names: SVP65; SYT; SytI
• UniProt Entry Name: SYT1_HUMAN

NCBI Description

The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al., 2001 [PubMed 11242035]).[supplied by OMIM, Jul 2010]

Uniprot Description

SYT1: an integral membrane protein of synaptic vesicles thought to serve as a Ca(2+) sensor in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin I participates in triggering neurotransmitter release at the synapse. Binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2.

Protein type: Vesicle; Calcium-binding; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12cen-q21

Cellular Component: cell junction; excitatory synapse; integral to membrane; neuron projection; plasma membrane; presynaptic membrane; SNARE complex; synaptic vesicle; synaptic vesicle membrane; terminal button

Molecular Function: calcium ion binding; calcium-dependent phospholipid binding; calcium-dependent protein binding; calmodulin binding; clathrin binding; identical protein binding; low-density lipoprotein receptor binding; phosphatidylinositol binding; phosphatidylinositol-4,5-bisphosphate binding; phosphatidylserine binding; protein binding; protein C-terminus binding; SNARE binding; syntaxin-1 binding

Biological Process: brain development; detection of calcium ion; glutamate secretion; neurotransmitter secretion; positive regulation of calcium ion-dependent exocytosis; positive regulation of synaptic transmission; positive regulation of vesicle fusion; protein homooligomerization; regulation of exocytosis; regulation of synaptic transmission, glutamatergic; synaptic transmission; synaptic vesicle endocytosis; vesicle docking