Protein sxy (sxy) Recombinant Protein | sxy recombinant protein

Recombinant Escherichia coli Protein sxy (sxy)

Cat. Num. AAA1072885

• Gene Names: sxy; ECK0950; JW0942; tfoX; yccR
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein sxy (sxy); Recombinant Escherichia coli Protein sxy (sxy); sxy recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-209, full length protein
• Sequence: MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE
• Sequence Length: 209

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16128926
• NCBI GeneID: 946504
• NCBI Accession #: NP_415479.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P75869
• Molecular Weight: 24,147 Da
• NCBI Official Full Name: CRP-S-dependent promoter expression factor
• NCBI Official Symbol: sxy
• NCBI Official Synonym Symbols: ECK0950; JW0942; tfoX; yccR
• NCBI Protein Information: CRP-S-dependent promoter expression factor
• UniProt Protein Name: Protein Sxy
• Protein Family: Protein
• UniProt Gene Name: sxy

NCBI Description

CRP-S are specialized CRP-dependent promoters that also require the Sxy gene product for expression (Cameron, 2006). [More information is available at EcoGene: EG13720]. Sxy is required for transcription from a subset of CRP-activated promoters. [More information is available at EcoCyc: G6494].

Uniprot Description

Induces low levels of natural DNA uptake by inducing transcription of the competence genes (the CRP-S regulon) required for DNA transformation. Induction of the CRP-S regulon also requires Sxy-activated promoter (CRP-S), cAMP receptor protein (CRP) and cAMP (PubMed:17068078, PubMed:22532864). Induces CRP-S site-containing genes which are involved in genome maintenance and transcription or encoding transposases and toxin-antitoxin pairs (PubMed:19502395).