Scytovirin Recombinant Protein | SVN recombinant protein

Recombinant Scytonema varium Scytovirin

Cat. Num. AAA9422572

• Purity: Greater than 90% as determined by SDS-PAGE.
• Synonyms: Scytovirin; Recombinant Scytonema varium Scytovirin; SVN recombinant protein

• Host: Yeast
• Purity/Purification: Greater than 90% as determined by SDS-PAGE.
• Form/Format: 20mM Tris-HCl based buffer, pH8.0
• Sequence Positions: Full Length, 1-95aa

• Target Length: Full lenght,1-95aa
• Tag Info: His-tag
• Target sequence: GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGGPTYGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA
• Target name: SVN
• Preparation and Storage: Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Related Product Information for SVN recombinant protein

Has strong anti-HIV activity against T-tropic strains of HIV-1 and weaker activity against M-tropic strains of HIV-1. Inhibits HIV-1 fusion and infection of CD4 LTR beta-gal cells in vitro. Inhibits fusion of HIV infected C-SS cells with uninfected C-SS cells, and fusion of HIV-1 Env expressing HL2/3 cells with CD4 LTR beta-gal cells. Binds to HIV gp120, HIV gp160 and to a lesser extent HIV gp41. Binding to HIV gp120 is glycosylation dependent. Binds with high specificity to the tetrasaccharide Man-alpha-1, 2-Man-alpha-1, 6-Man-alpha-1, 6-Man and also binds the higher-order oligosaccharides oligomannose 8 and oligomannose 9. Does not bind to monosaccharides, complex or hybrid N-linked oligosaccharides or chitin.

NCBI and Uniprot Product Information

• NCBI GI #: 209573788
• UniProt Accession #: P86041
• Molecular Weight: 11.72kD
• NCBI Official Full Name: Scytovirin
• UniProt Protein Name: Scytovirin
• Protein Family: Scytovirin
• UniProt Gene Name: SVN
• UniProt Synonym Gene Names: SVN

Uniprot Description

Has strong anti-HIV activity against T-tropic strains of HIV-1 and weaker activity against M-tropic strains of HIV-1. Inhibits HIV-1 fusion and infection of CD4 LTR beta-gal cells in vitro. Inhibits fusion of HIV infected CEM-SS cells with uninfected CEM-SS cells, and fusion of HIV-1 Env expressing HL2/3 cells with CD4 LTR beta-gal cells. Binds to HIV gp120, HIV gp160 and to a lesser extent HIV gp41. Binding to HIV gp120 is glycosylation dependent. Binds with high specificity to the tetrasaccharide Man-alpha-1,2-Man-alpha-1,6-Man-alpha-1,6-Man and also binds the higher-order oligosaccharides oligomannose 8 and oligomannose 9. Does not bind to monosaccharides, complex or hybrid N-linked oligosaccharides or chitin.